PRGDB00075602 (Pul.726)

From PRG Wiki
Jump to: navigation, search
Pul.726
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 148600601 (EL778697)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Pythium ultimum

Comment?

PUNB825TV Pythium ultimum ESTs Pythium ultimum DAOM BR144 cDNA clone PUNB825, mRNA sequence

DNA Sequence

CGGCCGGGGCGAACAGCTTGTCCACGACAAACGGCATCTTCACTCGTTCAGACGGATTCTGCTTTGTCATCAACTCGATCAGGTTCCACTGCTTGTCGTTCATCATTTCAGGACGCGTTGGAATGATGCCCTTTTTCACATGGAATTTGACGACAGCACTAATCTTGGTGCTTCCCCACGGAATATCGCCCGTGACTGCTTCCAGGATGCACATGGCAAACGAATACACGTCGGAGGCAAATGATGGGCGTCCACCAGCCAGATACTCAGGCGATTTCCAATGCACAGCGCCCATATTTTCCTCGCGGACCATGATTTCAGCGTCATTCACGACCGCACTCAACCCGAAGTCGATCAATTTCGCCTTCCCATCCATACCCACAAGCACATTGTCACATTTGAGATCGTTGTGAACGACATTCAATCCATGCACATACGCGAGTCCGAGCGCGACTTCGTAGAGTTTCTCCCAAACCAAATGGTCGTTTCCAGCTCGCTTCAAATAGTCTCGTAACTCTCCATTTGAAGCGTATTCACACACAAAATAGCGCTTGTCGACGTGACAGGCACCATACAACTCCACAATGTGCGGATGCTTCTTCAGTCGACGCCACACTCGTACTTCGTGAAGGAAGAGCTCGTTAGACATCGTGCCTTTGTCTCCTTCATACCCCATAAACTTCACCACAACAGGAGTGTCTAGCCAAACACCTTTATACACTTTTCCAAATGCGCCCTCTC


Protein sequences

Name Description Sequence
Pul.726 translated coding region predicted by ESTScan from UniGene Pul.726

XEGAFGKVYKGVWLDTPVVVKFMGYEGDKGTMSNELFLHEVRVWRRLKKHPHIVELYGACHVDKRYFVCEYASNGELRDYLKRAGNDHLVWEKLYEVALGLAYVHGLNVVHNDLKCDNVLVGMDGKAKLIDFGLSAVVNDAEIMVREENMGAVHWKSPEYLAGGRPSFASDVYSFAMCILEAVTGDIPWGSTKISAVVKFHVKKGIIPTRPEMMNDKQWNLIELMTKQNPSERVKMPFVVDKLFAPAX

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-245 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XEGAFGKVYKGVWLDTPVVVKFMGYEGDKGTMSNELFLHEVRVWRRLKKHPHIVELYGACHVDKRYFVCEYASNGELRDYLKRAGNDHLVWEKLYEVALGLAYVHGLNVVHNDLKCDNVLVGMDGKAKLIDFGLSAVVNDAEIMVREENMGAVHWKSPEYLAGGRPSFASDVYSFAMCILEAVTGDIPWGSTKISAVVKFHVKKGIIPTRPEMMNDKQWNLIELMTKQNPSERVKMPFVVDKLFA

Gene3D: G3DSA:3.30.200.20
2-58 no description

EGAFGKVYKGVWLDTPVVVKFMGYEGDKGTMSNELFLHEVRVWRRLKKHPHIVELYG

HMMPanther: PTHR23257:SF99
2-243 TGF-BETA-ACTIVATED KINASE 1,TGF-BETA-ACTIVATED KINASE 1

EGAFGKVYKGVWLDTPVVVKFMGYEGDKGTMSNELFLHEVRVWRRLKKHPHIVELYGACHVDKRYFVCEYASNGELRDYLKRAGNDHLVWEKLYEVALGLAYVHGLNVVHNDLKCDNVLVGMDGKAKLIDFGLSAVVNDAEIMVREENMGAVHWKSPEYLAGGRPSFASDVYSFAMCILEAVTGDIPWGSTKISAVVKFHVKKGIIPTRPEMMNDKQWNLIELMTKQNPSERVKMPFVVDKL

HMMPanther: PTHR23257
2-243 FAMILY NOT NAMED,Ser-thr,SERINE-THREONINE PROTEIN KINASE

EGAFGKVYKGVWLDTPVVVKFMGYEGDKGTMSNELFLHEVRVWRRLKKHPHIVELYGACHVDKRYFVCEYASNGELRDYLKRAGNDHLVWEKLYEVALGLAYVHGLNVVHNDLKCDNVLVGMDGKAKLIDFGLSAVVNDAEIMVREENMGAVHWKSPEYLAGGRPSFASDVYSFAMCILEAVTGDIPWGSTKISAVVKFHVKKGIIPTRPEMMNDKQWNLIELMTKQNPSERVKMPFVVDKL

HMMPfam: PF07714
IPR001245
2-243 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

EGAFGKVYKGVWLDTPVVVKFMGYEGDKGTMSNELFLHEVRVWRRLKKHPHIVELYGACHVDKRYFVCEYASNGELRDYLKRAGNDHLVWEKLYEVALGLAYVHGLNVVHNDLKCDNVLVGMDGKAKLIDFGLSAVVNDAEIMVREENMGAVHWKSPEYLAGGRPSFASDVYSFAMCILEAVTGDIPWGSTKISAVVKFHVKKGIIPTRPEMMNDKQWNLIELMTKQNPSERVKMPFVVDKL

superfamily: SSF56112
IPR011009
2-241 Protein kinase-like (PK-like)
Protein kinase-like domain

EGAFGKVYKGVWLDTPVVVKFMGYEGDKGTMSNELFLHEVRVWRRLKKHPHIVELYGACHVDKRYFVCEYASNGELRDYLKRAGNDHLVWEKLYEVALGLAYVHGLNVVHNDLKCDNVLVGMDGKAKLIDFGLSAVVNDAEIMVREENMGAVHWKSPEYLAGGRPSFASDVYSFAMCILEAVTGDIPWGSTKISAVVKFHVKKGIIPTRPEMMNDKQWNLIELMTKQNPSERVKMPFVVD

HMMSmart: SM00220
IPR002290
2-245 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

EGAFGKVYKGVWLDTPVVVKFMGYEGDKGTMSNELFLHEVRVWRRLKKHPHIVELYGACHVDKRYFVCEYASNGELRDYLKRAGNDHLVWEKLYEVALGLAYVHGLNVVHNDLKCDNVLVGMDGKAKLIDFGLSAVVNDAEIMVREENMGAVHWKSPEYLAGGRPSFASDVYSFAMCILEAVTGDIPWGSTKISAVVKFHVKKGIIPTRPEMMNDKQWNLIELMTKQNPSERVKMPFVVDKLFA

HMMSmart: SM00219
IPR020635
2-243 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

EGAFGKVYKGVWLDTPVVVKFMGYEGDKGTMSNELFLHEVRVWRRLKKHPHIVELYGACHVDKRYFVCEYASNGELRDYLKRAGNDHLVWEKLYEVALGLAYVHGLNVVHNDLKCDNVLVGMDGKAKLIDFGLSAVVNDAEIMVREENMGAVHWKSPEYLAGGRPSFASDVYSFAMCILEAVTGDIPWGSTKISAVVKFHVKKGIIPTRPEMMNDKQWNLIELMTKQNPSERVKMPFVVDKL

Gene3D: G3DSA:1.10.510.10
59-235 no description

ACHVDKRYFVCEYASNGELRDYLKRAGNDHLVWEKLYEVALGLAYVHGLNVVHNDLKCDNVLVGMDGKAKLIDFGLSAVVNDAEIMVREENMGAVHWKSPEYLAGGRPSFASDVYSFAMCILEAVTGDIPWGSTKISAVVKFHVKKGIIPTRPEMMNDKQWNLIELMTKQNPSERVK

PatternScan: PS00108
IPR008271
109-121 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VVHNDLKCDNVLV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox