PRGDB00075611 (Pul.2237)

From PRG Wiki
Jump to: navigation, search
Pul.2237
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 148605447 (EL782468)
Gene Class Unknown
Domain Type
Gene Species Pythium ultimum

Comment?

PUND257TV Pythium ultimum ESTs Pythium ultimum DAOM BR144 cDNA clone PUND257, mRNA sequence

DNA Sequence

CACGTCGACACGTCCACTGGTGTGCTCGCGCACGTGAAGGACTTTGCGGCTGCGATCCGCAAGCAACAACCAGATGCCATTGTTGTTGTCGATGGTGTGTGCGCGTTGGGTGGCGAGGAGTGCCGCATGAAGCAGTGGGACTTGGATGTTGTTCTTACTGGTTCGCAGAAGTGCGTCGGTGTTCCAGCCGGTCTGAGTCTTATGGTGATTCGTCCTCGTGCTCTTCAAGCGTTTGAGAAGTGCACCTCGACCACCAAGTACTACGTCGACTGGCGCAACTGGTTGCCAATCATGAAGAACTATGAAGCGCGTCAACCAAGCTACTTTGCGACTCCTGCGGTCAACCACTTGTTTGCTCTCAACAAGGGTTTGGACATCTTGTTGGAGAATGGTGGCATCGAGCAACGTTTCGTGGAACACAAACTTGTCGGTGATGCGATTAAGGAAGCGATGAAGGCTTTGGGTTGCTCGTTTGTCACTGTGGAAGGCAGTGGTGCGCATACGTTGACTTGTGTTCGATACCCTGCTGGCGTTGGCGCTACCGATTTCTTGCCAAAGGTGGTGAAGCGTGGTGTGTCGCTTGCTGGTGGACTGCACAAGAAGATCAAGACTGAATACTTCCGCATTGGTCACATGGGACCTAGCACCCGTCGCTTGGATCACGTTTTGAAGACTGTGCAAGCGATTGAAGAGGCTTTCATCGAATGTGGCCACAACGTTCCTGAAAAGGGCAAGGCTGCCAAGATCATCAAGAAGCTGCAATCCCAGATCCCAATCAAGCCAGCTTGCTCGTACACGATGGCGTACCATGGATGCCCAGTCCCACCAAAGTGCCAAGTGTGGACATCGGAACGCTCGTGGCTGCGTTCGCCGCTGGTTTCTTGATCTCTACCTTG


Protein sequences

Name Description Sequence
Pul.2237 translated coding region predicted by ESTScan from UniGene Pul.2237

HVDTSTGVLAHVKDFAAAIRKQQPDAIVVVDGVCALGGEECRMKQWDLDVVLTGSQKCVGVPAGLSLMVIRPRALQAFEKCTSTTKYYVDWRNWLPIMKNYEARQPSYFATPAVNHLFALNKGLDILLENGGIEQRFVEHKLVGDAIKEAMKALGCSFVTVEGSGAHTLTCVRYPAGVGATDFLPKVVKRGVSLAGGLHKKIKTEYFRIGHMGPSTRRLDHVLKTVQAIEEAFIECGHNVPEKGKAAKIIKKLQSQIPIKPACSYTMAYHGCPSPTKVPSVDIGTLVAAFAAGFLISTL

Domains

Domain Start-End Description Sequence

superfamily: SSF53383
IPR015424
1-237 PLP-dependent transferases
Pyridoxal phosphate-dependent transferase, major d

HVDTSTGVLAHVKDFAAAIRKQQPDAIVVVDGVCALGGEECRMKQWDLDVVLTGSQKCVGVPAGLSLMVIRPRALQAFEKCTSTTKYYVDWRNWLPIMKNYEARQPSYFATPAVNHLFALNKGLDILLENGGIEQRFVEHKLVGDAIKEAMKALGCSFVTVEGSGAHTLTCVRYPAGVGATDFLPKVVKRGVSLAGGLHKKIKTEYFRIGHMGPSTRRLDHVLKTVQAIEEAFIECG

Gene3D: G3DSA:3.40.640.10
IPR015421
1-118 no description
Pyridoxal phosphate-dependent transferase, major r

HVDTSTGVLAHVKDFAAAIRKQQPDAIVVVDGVCALGGEECRMKQWDLDVVLTGSQKCVGVPAGLSLMVIRPRALQAFEKCTSTTKYYVDWRNWLPIMKNYEARQPSYFATPAVNHLF

HMMPanther: PTHR21152:SF7
1-267 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

HVDTSTGVLAHVKDFAAAIRKQQPDAIVVVDGVCALGGEECRMKQWDLDVVLTGSQKCVGVPAGLSLMVIRPRALQAFEKCTSTTKYYVDWRNWLPIMKNYEARQPSYFATPAVNHLFALNKGLDILLENGGIEQRFVEHKLVGDAIKEAMKALGCSFVTVEGSGAHTLTCVRYPAGVGATDFLPKVVKRGVSLAGGLHKKIKTEYFRIGHMGPSTRRLDHVLKTVQAIEEAFIECGHNVPEKGKAAKIIKKLQSQIPIKPACSYTM

HMMPanther: PTHR21152
1-267 FAMILY NOT NAMED,AMINOTRANSFERASE CLASS V

HVDTSTGVLAHVKDFAAAIRKQQPDAIVVVDGVCALGGEECRMKQWDLDVVLTGSQKCVGVPAGLSLMVIRPRALQAFEKCTSTTKYYVDWRNWLPIMKNYEARQPSYFATPAVNHLFALNKGLDILLENGGIEQRFVEHKLVGDAIKEAMKALGCSFVTVEGSGAHTLTCVRYPAGVGATDFLPKVVKRGVSLAGGLHKKIKTEYFRIGHMGPSTRRLDHVLKTVQAIEEAFIECGHNVPEKGKAAKIIKKLQSQIPIKPACSYTM

HMMPfam: PF00266
IPR000192
1-199 Aminotran_5
Aminotransferase, class V/Cysteine desulfurase

HVDTSTGVLAHVKDFAAAIRKQQPDAIVVVDGVCALGGEECRMKQWDLDVVLTGSQKCVGVPAGLSLMVIRPRALQAFEKCTSTTKYYVDWRNWLPIMKNYEARQPSYFATPAVNHLFALNKGLDILLENGGIEQRFVEHKLVGDAIKEAMKALGCSFVTVEGSGAHTLTCVRYPAGVGATDFLPKVVKRGVSLAGGLH

PatternScan: PS00595
IPR020578
48-68 AA_TRANSFER_CLASS_5
Aminotransferase class-V pyridoxal-phosphate bindi

LDVVLTGSQKCVGVPAGLSLM

Gene3D: G3DSA:3.90.1150.10
IPR015422
119-242 no description
Pyridoxal phosphate-dependent transferase, major r

ALNKGLDILLENGGIEQRFVEHKLVGDAIKEAMKALGCSFVTVEGSGAHTLTCVRYPAGVGATDFLPKVVKRGVSLAGGLHKKIKTEYFRIGHMGPSTRRLDHVLKTVQAIEEAFIECGHNVPE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox