PRGDB00075614 (Pul.2703)

From PRG Wiki
Jump to: navigation, search
Pul.2703
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 148602463 (EL782640)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Pythium ultimum

Comment?

PUNCU86TVC Pythium ultimum ESTs Pythium ultimum DAOM BR144 cDNA clone PUNCU86, mRNA sequence

DNA Sequence

CGGCCGGGGGGGCGCAGATCACTGAAAACGGACGCAAGCAAGCAGACAACGAGGTGATCCTGCTCAAGTCGCTGTACCACGTGAACATTGTGCGCTTTTACGACCATTTTCTCGTCGACGATGAGCTCAATATCGTCATGGAGTACTCGGATGGCGGCAACTTGCGTCAGCTTGTGAAGATGCGCTCACGCGAGAAGATGGGGCCGTTCCCGGAAGGTGTGATCATGAGCTGGTTTGCGCAACTCGCGCTCGCTGTCGCGTATATCCATGGGAAGAACGTGCTTCACCGTGACCTGAAGGCGCAAAACGTGTTCCTTACGCGTAAGAATGTAGTGAAACTGGGCGATTTTGGTATTTCGAAAGCGCTTGCTGGTGACGATACGGCGAATACCGCGTGTGGTACTCCAGAGAGTATGTCGCCAGAGATTTGCCGCGGTGAGCCCTACGGGAAGAAGTCGGATATCTGGTCACTTGGTTGCATTTTGTACGAGATGATCATGCTCAAGCGGCCATTCGAGGCGTCGACGCTGCCTGAGATCTTCACGAAGATCTGCAAGGGTGATTATCCGCCAATTCTGCCTTCTTTCTCGCGCGAATTGCGATTGCTCGTTCAGCTCATGCTGCAGCAGGACTCGTCCAAGCGTCCTTCGATCGAAGACATTTGCCGATTCCCATTTGTGCAAGCTCCCATCCAAGCGTTCCTTTCGCAGCACGTGTCGGAGTTCCAAGAAGCGCTGGAGCTGGAGGCGAAGCTCCACCAGCCATCGCTGTACAGCATGGGTGTTCGCAATACGCCGATTTCGCCTGTGTCCCCATCGATACGCCGTCGTAACCCGAATG


Protein sequences

Name Description Sequence
Pul.2703 translated coding region predicted by ESTScan from UniGene Pul.2703

XAGGAQITENGRKQADNEVILLKSLYHVNIVRFYDHFLVDDELNIVMEYSDGGNLRQLVKMRSREKMGPFPEGVIMSWFAQLALAVAYIHGKNVLHRDLKAQNVFLTRKNVVKLGDFGISKALAGDDTANTACGTPESMSPEICRGEPYGKKSDIWSLGCILYEMIMLKRPFEASTLPEIFTKICKGDYPPILPSFSRELRLLVQLMLQQDSSKRPSIEDICRFPFVQAPIQAFLSQHVSEFQEALELEAKLHQPSLYSMGVRNTPISPVSPSIRRRNPNX

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-227 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XAGGAQITENGRKQADNEVILLKSLYHVNIVRFYDHFLVDDELNIVMEYSDGGNLRQLVKMRSREKMGPFPEGVIMSWFAQLALAVAYIHGKNVLHRDLKAQNVFLTRKNVVKLGDFGISKALAGDDTANTACGTPESMSPEICRGEPYGKKSDIWSLGCILYEMIMLKRPFEASTLPEIFTKICKGDYPPILPSFSRELRLLVQLMLQQDSSKRPSIEDICRFPFV

HMMSmart: SM00220
IPR002290
3-227 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

GGAQITENGRKQADNEVILLKSLYHVNIVRFYDHFLVDDELNIVMEYSDGGNLRQLVKMRSREKMGPFPEGVIMSWFAQLALAVAYIHGKNVLHRDLKAQNVFLTRKNVVKLGDFGISKALAGDDTANTACGTPESMSPEICRGEPYGKKSDIWSLGCILYEMIMLKRPFEASTLPEIFTKICKGDYPPILPSFSRELRLLVQLMLQQDSSKRPSIEDICRFPFV

HMMSmart: SM00219
IPR020635
7-225 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

ITENGRKQADNEVILLKSLYHVNIVRFYDHFLVDDELNIVMEYSDGGNLRQLVKMRSREKMGPFPEGVIMSWFAQLALAVAYIHGKNVLHRDLKAQNVFLTRKNVVKLGDFGISKALAGDDTANTACGTPESMSPEICRGEPYGKKSDIWSLGCILYEMIMLKRPFEASTLPEIFTKICKGDYPPILPSFSRELRLLVQLMLQQDSSKRPSIEDICRFP

superfamily: SSF56112
IPR011009
8-258 Protein kinase-like (PK-like)
Protein kinase-like domain

TENGRKQADNEVILLKSLYHVNIVRFYDHFLVDDELNIVMEYSDGGNLRQLVKMRSREKMGPFPEGVIMSWFAQLALAVAYIHGKNVLHRDLKAQNVFLTRKNVVKLGDFGISKALAGDDTANTACGTPESMSPEICRGEPYGKKSDIWSLGCILYEMIMLKRPFEASTLPEIFTKICKGDYPPILPSFSRELRLLVQLMLQQDSSKRPSIEDICRFPFVQAPIQAFLSQHVSEFQEALELEAKLHQPSLY

Gene3D: G3DSA:3.30.200.20
9-57 no description

ENGRKQADNEVILLKSLYHVNIVRFYDHFLVDDELNIVMEYSDGGNLRQ

HMMPfam: PF00069
IPR017442
10-227 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

NGRKQADNEVILLKSLYHVNIVRFYDHFLVDDELNIVMEYSDGGNLRQLVKMRSREKMGPFPEGVIMSWFAQLALAVAYIHGKNVLHRDLKAQNVFLTRKNVVKLGDFGISKALAGDDTANTACGTPESMSPEICRGEPYGKKSDIWSLGCILYEMIMLKRPFEASTLPEIFTKICKGDYPPILPSFSRELRLLVQLMLQQDSSKRPSIEDICRFPFV

HMMPanther: PTHR24362
12-242 FAMILY NOT NAMED,SERINE/THREONINE-PROTEIN KINASE NEK

RKQADNEVILLKSLYHVNIVRFYDHFLVDDELNIVMEYSDGGNLRQLVKMRSREKMGPFPEGVIMSWFAQLALAVAYIHGKNVLHRDLKAQNVFLTRKNVVKLGDFGISKALAGDDTANTACGTPESMSPEICRGEPYGKKSDIWSLGCILYEMIMLKRPFEASTLPEIFTKICKGDYPPILPSFSRELRLLVQLMLQQDSSKRPSIEDICRFPFVQAPIQAFLSQHVSEF

FPrintScan: PR00109
IPR001245
47-60 TYRKINASE
Serine-threonine/tyrosine-protein kinase

MEYSDGGNLRQLVK

Gene3D: G3DSA:1.10.510.10
58-245 no description

LVKMRSREKMGPFPEGVIMSWFAQLALAVAYIHGKNVLHRDLKAQNVFLTRKNVVKLGDFGISKALAGDDTANTACGTPESMSPEICRGEPYGKKSDIWSLGCILYEMIMLKRPFEASTLPEIFTKICKGDYPPILPSFSRELRLLVQLMLQQDSSKRPSIEDICRFPFVQAPIQAFLSQHVSEFQEA

FPrintScan: PR00109
IPR001245
88-106 TYRKINASE
Serine-threonine/tyrosine-protein kinase

YIHGKNVLHRDLKAQNVFL

PatternScan: PS00108
IPR008271
94-106 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VLHRDLKAQNVFL

FPrintScan: PR00109
IPR001245
153-175 TYRKINASE
Serine-threonine/tyrosine-protein kinase

SDIWSLGCILYEMIMLKRPFEAS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox