PRGDB00076083 (Rsa.2259)

From PRG Wiki
Jump to: navigation, search
Rsa.2259
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 156171671 (EW731817)
Gene Class Unknown
Domain Type
Gene Species Raphanus sativus

Comment?

RS3A873TF RS3(RT) Raphanus sativus cDNA 5', mRNA sequence

DNA Sequence

GGAGGAGCTTCCGCCTTACTCAGAGGAGGAGAAACAAGAACAGGGCAAAAATGGACTATATGAATGCACCCGGGAGACACCATCTTTTCGTGCCAGGACCAGTGAACATACCGGAGCAGGTGATCCGGGCGATGAACAGAAACAACGAGGATTACCGGTCACCAGCCATCCCGGCACTTACAAAAACGTTGTTGGAGGACGTGAAGAAGATATTCAAGACAACATCTGGAACACCGTTTATGTTTCCAACTACTGGCACTGGTGCTTGGGAGAGTGCCTTGACCAACACGCTATCTCCTGGAGACAGGATCGTCTCGTTTCTGATTGGGCAGTTTAGCTTGCTGTGGATTGACCAGCAGAAGAGGCTAAACTTCAACGTTGATGTGGTGGAGAGTGATTGGGGACAAGGTGCTAATCTCCAAGTCTTGGCCTCAAAGCTCTCACAGGACCAAAATCATTCCATCAAAGCCATTTGTATTGTCCACAACGAGACCGCGACTGGAGTCACTAATGACATCTCTGCCGTCCGAACCCTCCTCGATCACTACAAGCACCCGGCTTTGCTGCTTGTGGACGGTGTCTCGTCCATATGTGCGCTTGATTTCCGAATGGATGAGTGGGGAGTGGATGTGGCCTTGACCGGATCTCAGAAAGCTTTATCCCTTCCAACAGCCTTGGTATTGTGTGCGCCAGTCCAAAAGCTTTGGAAGCTACCAAAACTTCAAAATCCCTCAAAGTCTTCTTTGATTGGAATGACTACCTCAAGTTTTACAAGCTCGGGACATATTGGCCATACACACCTTCCATTCACTCCTCTACGTCTAGAGCTGCTCTGATCTATCTTTGAGACGACTTGAAATGTCATCGCCCGTCACG


Protein sequences

Name Description Sequence
Rsa.2259 translated coding region predicted by ESTScan from UniGene Rsa.2259

MDYMNAPGRHHLFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSGTPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESDWGQGANLQVLASKLSQDQNHSIKAICIVHNETATGVTNDISAVRTLLDHYKHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTALVLCAPVQKLWKLPKLQNPSKSSLIGMTTSSFTSSGHIGHTHLPFTPLRLELL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR21152:SF7
1-207 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MDYMNAPGRHHLFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSGTPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESDWGQGANLQVLASKLSQDQNHSIKAICIVHNETATGVTNDISAVRTLLDHYKHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPT

HMMPanther: PTHR21152
1-207 FAMILY NOT NAMED,AMINOTRANSFERASE CLASS V

MDYMNAPGRHHLFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSGTPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESDWGQGANLQVLASKLSQDQNHSIKAICIVHNETATGVTNDISAVRTLLDHYKHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPT

superfamily: SSF53383
IPR015424
7-209 PLP-dependent transferases
Pyridoxal phosphate-dependent transferase, major d

PGRHHLFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSGTPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESDWGQGANLQVLASKLSQDQNHSIKAICIVHNETATGVTNDISAVRTLLDHYKHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTAL

HMMPfam: PF00266
IPR000192
12-206 Aminotran_5
Aminotransferase, class V/Cysteine desulfurase

LFVPGPVNIPEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSGTPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESDWGQGANLQVLASKLSQDQNHSIKAICIVHNETATGVTNDISAVRTLLDHYKHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLP

Gene3D: G3DSA:3.40.640.10
IPR015421
21-208 no description
Pyridoxal phosphate-dependent transferase, major r

PEQVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSGTPFMFPTTGTGAWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESDWGQGANLQVLASKLSQDQNHSIKAICIVHNETATGVTNDISAVRTLLDHYKHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTA

Seg: seg
57-71 seg

TTSGTPFMFPTTGTG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox