PRGDB00076089 (Rsa.3235)

From PRG Wiki
Jump to: navigation, search
Rsa.3235
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 156178726 (EW738872)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Raphanus sativus

Comment?

RS3AY24JQ RS3(RT) Raphanus sativus cDNA 3', mRNA sequence

DNA Sequence

GACTACTAGAATATCTCGAAATGTATTTATaaagaaaaaatcaagaaaaaaaTAGATGGGAGATGCCATCTTTTAAGAACTTGGTTCAAATGCCACACTGGTCTGGTCCAGCCTTTTTTTGCTTTAACGTAACCCAACAAAGACCTAACACACttttttttATCTCCTTTTGAGGAGAAAGTGAACACACACAAGCTAAAGCTGCTTTGAGTTACTACTAAGGCGTGACCGAACGTGGTGGCGTCCTTGATTCCCCTGGAGGAGTCTGACCCTCTGAACCTTTGGACGGGTCATCAGACGATTGTCTTAACCCGTCATCGGTTGTTTCACTTCTGTTCACATCCTCGATCATTCTCAGCACTTCCTGCATTACCGGTCGTTGATCAGGAACCGTAGCGACACAAGCCATTGCGATTTGAAGAAGCTGAACCATCTCTTCCTCTATGTTGTGGTACCGCATCAGCTCAACATCGAATACTTCAGCGGTCCATTCTTCTCTAACCACAGACAGCACCCACCGAGGTAGATCAATGCCTTCTTCGCCAAGTGATGCCTGGTTTGGTGATTTGCCAGTCAACAGTTCAAGTAGCAACACCCCGAAACTGTACACATCTGATTTGAAAGTTACTTTCCGTGTCTCGAGAACTTCGGGAGCATGATAACCCGCCAAACGGTTTGGTGGACTAGAGTTACTGAACAGTTGGTTAAGTCCATAGTCAGAGACGCAAGTGTCTTGGTTTGGTTGTAGGAGTATGTTTGAGGCTTTGATGTTTCCGTGTACCAATTTGGCTGAAACATGAAGAT


Protein sequences

Name Description Sequence
Rsa.3235 translated coding region predicted by ESTScan from UniGene Rsa.3235

XLHVSAKLVHGNIKASNILLQPNQDTCVSDYGLNQLFSNSSPPNRLAGYHAPEVLETRKVTFKSDVYSFGVLLLELLTGKSPNQASLGEEGIDLPRWVLSVVREEWTAEVFDVELMRYHNIEEEMVQLLQIAMACVATVPDQRPVMQEVLRMIEDVNRSETTDDGLRQSSDDPSKGSEGQTPPGESRTPPRSVTP

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-156 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XLHVSAKLVHGNIKASNILLQPNQDTCVSDYGLNQLFSNSSPPNRLAGYHAPEVLETRKVTFKSDVYSFGVLLLELLTGKSPNQASLGEEGIDLPRWVLSVVREEWTAEVFDVELMRYHNIEEEMVQLLQIAMACVATVPDQRPVMQEVLRMIEDV

superfamily: SSF56112
IPR011009
2-153 Protein kinase-like (PK-like)
Protein kinase-like domain

LHVSAKLVHGNIKASNILLQPNQDTCVSDYGLNQLFSNSSPPNRLAGYHAPEVLETRKVTFKSDVYSFGVLLLELLTGKSPNQASLGEEGIDLPRWVLSVVREEWTAEVFDVELMRYHNIEEEMVQLLQIAMACVATVPDQRPVMQEVLRMI

HMMPanther: PTHR24420:SF779
2-195 SUBFAMILY NOT NAMED

LHVSAKLVHGNIKASNILLQPNQDTCVSDYGLNQLFSNSSPPNRLAGYHAPEVLETRKVTFKSDVYSFGVLLLELLTGKSPNQASLGEEGIDLPRWVLSVVREEWTAEVFDVELMRYHNIEEEMVQLLQIAMACVATVPDQRPVMQEVLRMIEDVNRSETTDDGLRQSSDDPSKGSEGQTPPGESRTPPRSVTP

HMMPanther: PTHR24420
2-195 FAMILY NOT NAMED,FAMILY NOT NAMED

LHVSAKLVHGNIKASNILLQPNQDTCVSDYGLNQLFSNSSPPNRLAGYHAPEVLETRKVTFKSDVYSFGVLLLELLTGKSPNQASLGEEGIDLPRWVLSVVREEWTAEVFDVELMRYHNIEEEMVQLLQIAMACVATVPDQRPVMQEVLRMIEDVNRSETTDDGLRQSSDDPSKGSEGQTPPGESRTPPRSVTP

Gene3D: G3DSA:1.10.510.10
3-180 no description

HVSAKLVHGNIKASNILLQPNQDTCVSDYGLNQLFSNSSPPNRLAGYHAPEVLETRKVTFKSDVYSFGVLLLELLTGKSPNQASLGEEGIDLPRWVLSVVREEWTAEVFDVELMRYHNIEEEMVQLLQIAMACVATVPDQRPVMQEVLRMIEDVNRSETTDDGLRQSSDDPSKGSEGQ

HMMPfam: PF07714
IPR001245
5-152 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

SAKLVHGNIKASNILLQPNQDTCVSDYGLNQLFSNSSPPNRLAGYHAPEVLETRKVTFKSDVYSFGVLLLELLTGKSPNQASLGEEGIDLPRWVLSVVREEWTAEVFDVELMRYHNIEEEMVQLLQIAMACVATVPDQRPVMQEVLRM






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox