PRGDB00076138 (Rsa.9771)

From PRG Wiki
Jump to: navigation, search
Rsa.9771
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 156178168 (EW738314)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Raphanus sativus

Comment?

RS3B037JQ RS3(RT) Raphanus sativus cDNA 3', mRNA sequence

DNA Sequence

ACAAGTAATAACCAATACAAGAATTATGTTACATCATATGTTACATTCATCAAAAGGATGTGTTGATGATGCCCATTAAAACAAGAATCTGAACAAATAAAATATAGTATGTTTCTGCGTCGTAGTCTTAAAAGGTTGTAGATATCTTAGATCATACGTTGAAGATCTTGGACAATTTCTGATACACGCGGTCTGAATCCTGGTTCCATCTGGAGAGAACGTGATATGATATCTGCAAAACGTGACAAAGATTTCACTGAATATGCTCCATGTAACGACGGATCAACCATTCTTGTCAACGCATCTATGTCATGAAGCCGAGGTGTAGCCCATTGAGCTAGTGTCTGATTTCCCCGCCTTGTCCTGTCAAATGGTCTGCTTCCAGTTAGCAGTTATAACATGACAACACCAAGGCTATATACATCGCTTTGACAAGTGTAGCTTCCATACTCAACCTCAGGTGCCGCATAACCCGCCATCTGACTCGTTGGACGTGGTGGTAACATATAAGCCAAACCACTATCTGCAACACGTACCGAGAGCTTTCCATCAAGTAGAACCTTGGAAGACTTGAAGTTCTGGTGTACAACAGGTGGTTGACACACCTCATGAAGAAACTGAAGTGCCTTGGTAGCTCCTAACGCGATATTCATACGCACATTCCAAGTGAGCTTCTTGTTCAATTTGCGGTCAAATGAAGTGCGTCTTGAAGTGATCCATAAGGACAGTACTCATACACAAGCAGCCTTTGACCATACTCGTTACAGTAACCAAGAAA


Protein sequences

Name Description Sequence
Rsa.9771 translated coding region predicted by ESTScan from UniGene Rsa.9771

FLGYCNEYGQRLLVYEYCPYGSLQDXTSFDRKLNKKLTWNVRMNIALGATKALQFLHEVCQPPVVHQNFKSSKVLLDGKLSVRVADSGLAYMLPPRPTSQMAGYAAPEVEYGSYTCQSDVYSLGVVMLXLLTGSRPFDRTRRGNQTLAQWATPRLHDIDALTRMVDPSLHGAYSVKSLSRFADIISRSLQMEPGFRPRVSEIVQDLQRMI

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-210 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FLGYCNEYGQRLLVYEYCPYGSLQDXTSFDRKLNKKLTWNVRMNIALGATKALQFLHEVCQPPVVHQNFKSSKVLLDGKLSVRVADSGLAYMLPPRPTSQMAGYAAPEVEYGSYTCQSDVYSLGVVMLXLLTGSRPFDRTRRGNQTLAQWATPRLHDIDALTRMVDPSLHGAYSVKSLSRFADIISRSLQMEPGFRPRVSEIVQDLQRMI

superfamily: SSF56112
IPR011009
1-206 Protein kinase-like (PK-like)
Protein kinase-like domain

FLGYCNEYGQRLLVYEYCPYGSLQDXTSFDRKLNKKLTWNVRMNIALGATKALQFLHEVCQPPVVHQNFKSSKVLLDGKLSVRVADSGLAYMLPPRPTSQMAGYAAPEVEYGSYTCQSDVYSLGVVMLXLLTGSRPFDRTRRGNQTLAQWATPRLHDIDALTRMVDPSLHGAYSVKSLSRFADIISRSLQMEPGFRPRVSEIVQDL

HMMSmart: SM00220
IPR002290
1-210 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FLGYCNEYGQRLLVYEYCPYGSLQDXTSFDRKLNKKLTWNVRMNIALGATKALQFLHEVCQPPVVHQNFKSSKVLLDGKLSVRVADSGLAYMLPPRPTSQMAGYAAPEVEYGSYTCQSDVYSLGVVMLXLLTGSRPFDRTRRGNQTLAQWATPRLHDIDALTRMVDPSLHGAYSVKSLSRFADIISRSLQMEPGFRPRVSEIVQDLQRMI

HMMSmart: SM00219
IPR020635
1-206 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FLGYCNEYGQRLLVYEYCPYGSLQDXTSFDRKLNKKLTWNVRMNIALGATKALQFLHEVCQPPVVHQNFKSSKVLLDGKLSVRVADSGLAYMLPPRPTSQMAGYAAPEVEYGSYTCQSDVYSLGVVMLXLLTGSRPFDRTRRGNQTLAQWATPRLHDIDALTRMVDPSLHGAYSVKSLSRFADIISRSLQMEPGFRPRVSEIVQDL

HMMPanther: PTHR24420:SF482
2-210 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

LGYCNEYGQRLLVYEYCPYGSLQDXTSFDRKLNKKLTWNVRMNIALGATKALQFLHEVCQPPVVHQNFKSSKVLLDGKLSVRVADSGLAYMLPPRPTSQMAGYAAPEVEYGSYTCQSDVYSLGVVMLXLLTGSRPFDRTRRGNQTLAQWATPRLHDIDALTRMVDPSLHGAYSVKSLSRFADIISRSLQMEPGFRPRVSEIVQDLQRMI

HMMPanther: PTHR24420
2-210 FAMILY NOT NAMED,FAMILY NOT NAMED

LGYCNEYGQRLLVYEYCPYGSLQDXTSFDRKLNKKLTWNVRMNIALGATKALQFLHEVCQPPVVHQNFKSSKVLLDGKLSVRVADSGLAYMLPPRPTSQMAGYAAPEVEYGSYTCQSDVYSLGVVMLXLLTGSRPFDRTRRGNQTLAQWATPRLHDIDALTRMVDPSLHGAYSVKSLSRFADIISRSLQMEPGFRPRVSEIVQDLQRMI

HMMPfam: PF00069
IPR017442
3-205 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

GYCNEYGQRLLVYEYCPYGSLQDXTSFDRKLNKKLTWNVRMNIALGATKALQFLHEVCQPPVVHQNFKSSKVLLDGKLSVRVADSGLAYMLPPRPTSQMAGYAAPEVEYGSYTCQSDVYSLGVVMLXLLTGSRPFDRTRRGNQTLAQWATPRLHDIDALTRMVDPSLHGAYSVKSLSRFADIISRSLQMEPGFRPRVSEIVQD

Gene3D: G3DSA:1.10.510.10
12-206 no description

LLVYEYCPYGSLQDXTSFDRKLNKKLTWNVRMNIALGATKALQFLHEVCQPPVVHQNFKSSKVLLDGKLSVRVADSGLAYMLPPRPTSQMAGYAAPEVEYGSYTCQSDVYSLGVVMLXLLTGSRPFDRTRRGNQTLAQWATPRLHDIDALTRMVDPSLHGAYSVKSLSRFADIISRSLQMEPGFRPRVSEIVQDL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox