PRGDB00076139 (Rsa.9851)

From PRG Wiki
Jump to: navigation, search
Rsa.9851
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 156178693 (EW738839)
Gene Class Mlo-like
Domain Type MLO
Gene Species Raphanus sativus

Comment?

RS3AT77JQ RS3(RT) Raphanus sativus cDNA 3', mRNA sequence

DNA Sequence

CGAATGTAATCATCTATCTTTATAGATGGTGCAGGTCTCGTACAATACATGTAATAATGTATAACATATGTAAATCAAGAATCATCTACCTCTTAAAGGAAAAATCTCTTGAGCTTTTGGTAGTCCGTATATGAGGAAGTTCAACGGAAGCAAGAACAGGTTCCTTTTCTGAGCTTTCGTGCGCAAGAAAATGATGTGTGGAAGGTCCAGCTTCTTGGCGTTGAGACTCAGGATCCCAAAACTGGTGGTGGTCATGACGATCAGAGTATCTAGGAAAAGGAGAGCTCGGGAAAGTCTCAACGCTTCGGTTATTAAGAATATGTATCGGAAATGAGGCGTGAGTTGGTGTAGTTGGACGGCTAGTGTAAGGTGTGTTTGATTCAGTGTGTTTCCCGTGTTTTGTGTGCTTCTTTGCTGTGTGATGCCATGTCTTTATCGCTGTGGCTACTCTTTCGTTGAACACAGTTGGCCTCATCGTAGAACCCATCTGAGTGACAAGAGCATAGAGTGGAAGAGTCACATAGCTGCAAAGTATCTGTACAACAACTCCAACTACAATTCTAATGACCACATCTGCATCGCTTTCATGGAAACAATTCTTGAGAGTGAATTCGTACGTACTCCAGGCAAAGAAGGCAAGCTGAAATGCATTCGTGAAAAGAACCAAGTGGATAAGGAAAAGGATGAACCGAGGGCGGCCAAACCAGAAGAGATCATCACCGGGTTGAACCACAGGGGCACCTCTCACCACATCACCTTTCTCTTGGATTCTTAGACACAATT


Protein sequences

Name Description Sequence
Rsa.9851 translated coding region predicted by ESTScan from UniGene Rsa.9851

XLCLRIQEKGDVVRGAPVVQPGDDLFWFGRPRFILFLIHLVLFTNAFQLAFFAWSTYEFTLKNCFHESDADVVIRIVVGVVVQILCSYVTLPLYALVTQMGSTMRPTVFNERVATAIKTWHHTAKKHTKHGKHTESNTPYTSRPTTPTHASFPIHILNNRSVETFPSSPFPRYSDRHDHHQFWDPESQRQEAGPSTHHFLAHESSEKEPVLASVELPHIRTTKSSRDFSFKR

Domains

Domain Start-End Description Sequence

HMMPfam: PF03094
IPR004326
2-161 Mlo
Mlo-related protein

LCLRIQEKGDVVRGAPVVQPGDDLFWFGRPRFILFLIHLVLFTNAFQLAFFAWSTYEFTLKNCFHESDADVVIRIVVGVVVQILCSYVTLPLYALVTQMGSTMRPTVFNERVATAIKTWHHTAKKHTKHGKHTESNTPYTSRPTTPTHASFPIHILNNRS

Seg: seg
72-84 seg

VVIRIVVGVVVQI

Seg: seg
114-134 seg

ATAIKTWHHTAKKHTKHGKHT






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox