PRGDB00076245 (Rsa.22162)

From PRG Wiki
Jump to: navigation, search
Rsa.22162
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 156177914 (EW738060)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Raphanus sativus

Comment?

RS3B489JQ RS3(RT) Raphanus sativus cDNA 3', mRNA sequence

DNA Sequence

GGATACATTAGTACCCCGAAAATATCTCTCTAGTATCTTCTGTGTCATACACTTATGGAATGTTCTATTAGTACCTAGACCTAGATCTCTCTGCGTACTCTGTATATATACTTGTACATTCTCATTGTATATGTATAACACACCACTTCTATACTATACACGTCTGCTTTCTCGCAATTAAACCTTTGATATTACAATGACTAGGAAAAAAACTCTGCTGTGGAGTTTGAGGTGGCTGATCCTTGATTAAATGGGGACAGTCCATAACCAGACATCGAGGTTGACTCTTGCATCTCCATCAGCTTTGAAAAGTTCAAATCATGTCCATACACGGCAGGACCTGACATAATCTGTGGTATTTCCATCTCTCCCTCCAGCATTTTCACTGCCTCTGACATCAATGGCCGTAACGAGGGAGTTGCGTTTGTGCAAACAAGAGCAACTCTGATCATCCTCTCTGCTTCTAGGCTCTTGTACTCACCTTCGAGCTTCGGATCTACTATCTCCATTATGTCCCCTTTTTGTTGCAGTGTCATGGCCCATTTAATAAGTGGGGCGTTGTCATCGCTTCCCTTTTGTGTTGTATTACTTTACCCACTAACAATCTCCATTGCCACAACCCCAAAGCTGTACACATCTGCTTTCTCGGTCAAATGACCCATTAAAGCATATTCTGGAGCCATATATCCGATGGTTCCTGCAACTTTTGTGCTAATGTGAGTGTGTTCTTCTTCATGGA


Protein sequences

Name Description Sequence
Rsa.22162 translated coding region predicted by ESTScan from UniGene Rsa.22162

XHEEEHTHISTKVAGTIGYMAPEYALMGHLTEKADVYSFGVVAMEIVSGXSNTTQKGSDDNAPLIKWAMTLQQKGDIMEIVDPKLEGEYKSLEAERMIRVALVCTNATPSLRPLMSEAVKMLEGEMEIPQIMSGPAVYGHDLNFSKLMEMQESTSMSGYGLSPFNQGSATSNSTAEFFS

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-131 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XHEEEHTHISTKVAGTIGYMAPEYALMGHLTEKADVYSFGVVAMEIVSGXSNTTQKGSDDNAPLIKWAMTLQQKGDIMEIVDPKLEGEYKSLEAERMIRVALVCTNATPSLRPLMSEAVKMLEGEMEIPQI

HMMPanther: PTHR24420:SF695
2-163 KINASE/ PROTEIN SERINE/THREONINE KINASE

HEEEHTHISTKVAGTIGYMAPEYALMGHLTEKADVYSFGVVAMEIVSGXSNTTQKGSDDNAPLIKWAMTLQQKGDIMEIVDPKLEGEYKSLEAERMIRVALVCTNATPSLRPLMSEAVKMLEGEMEIPQIMSGPAVYGHDLNFSKLMEMQESTSMSGYGLSP

HMMPanther: PTHR24420
2-163 FAMILY NOT NAMED,FAMILY NOT NAMED

HEEEHTHISTKVAGTIGYMAPEYALMGHLTEKADVYSFGVVAMEIVSGXSNTTQKGSDDNAPLIKWAMTLQQKGDIMEIVDPKLEGEYKSLEAERMIRVALVCTNATPSLRPLMSEAVKMLEGEMEIPQIMSGPAVYGHDLNFSKLMEMQESTSMSGYGLSP

Gene3D: G3DSA:1.10.510.10
5-122 no description

EHTHISTKVAGTIGYMAPEYALMGHLTEKADVYSFGVVAMEIVSGXSNTTQKGSDDNAPLIKWAMTLQQKGDIMEIVDPKLEGEYKSLEAERMIRVALVCTNATPSLRPLMSEAVKML

HMMPfam: PF00069
IPR017442
6-120 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

HTHISTKVAGTIGYMAPEYALMGHLTEKADVYSFGVVAMEIVSGXSNTTQKGSDDNAPLIKWAMTLQQKGDIMEIVDPKLEGEYKSLEAERMIRVALVCTNATPSLRPLMSEAVK

superfamily: SSF56112
IPR011009
8-168 Protein kinase-like (PK-like)
Protein kinase-like domain

HISTKVAGTIGYMAPEYALMGHLTEKADVYSFGVVAMEIVSGXSNTTQKGSDDNAPLIKWAMTLQQKGDIMEIVDPKLEGEYKSLEAERMIRVALVCTNATPSLRPLMSEAVKMLEGEMEIPQIMSGPAVYGHDLNFSKLMEMQESTSMSGYGLSPFNQGS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox