PRGDB00076247 (Rsa.22215)

From PRG Wiki
Jump to: navigation, search
Rsa.22215
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 156178046 (EW738192)
Gene Class Unknown
Domain Type
Gene Species Raphanus sativus

Comment?

RS3B671JQ RS3(RT) Raphanus sativus cDNA 3', mRNA sequence

DNA Sequence

CGGAACTAATAAGCTTAAAAAACACTTCTAAACTTATAGTACAACTGAAGCAACAAGAGTGTTAAAACATACTTGGAAACAAAGAAGAAACAGATATAAGACAACTTCAAAAGAGAATACAAACTCAAGAGGAGGGAAAGAGAGAATAAAAGAGGAAACATTTCAAACTATTTGTATCATTACTGATGAAAAAATCTGCAGAAGAAACAGCTCACCTGATGCTTCTTCTCCTCTTTACAGGTTCTGTTTTCCTTTCCTGTTTACAATAATATCAGATCTTTTCTCATTTATGGGCATTATTATCAACTGCCTCACCAATCTCATCATCATCTTCTTTCGGATTTCACAAGTTGAGAGAACACTTTACTCATGGAAACACCAGAGAGATCATCAATGCTCGATTCCTCAAACCGTCCGTTGGTTCCAGGAACGTTAACGCTCGAGTCCCCCTGACTGAAGTTGTTGATCTGCGGAGGCAACTCTCCAATCATATTCGTGCTGTTATCTTCCGGCTCACCGTCTATGACTGCTTCTTGCAGCTGCAGAGCGTACTCAAGATTCCACAGCACGTCTCCCATAGACGGCCTATCGACTCCATAATCAGCCAAACATTTCTCCCCCGTCTCAGCAAACTTCCTCAACGAATATGGTCTGATGTTTCCTCGTAACGACTGGTCAACGATCTGATCCAACTGCCCTTTCTTCTGCCACTTCATCGCCCACTCCGCGAGATCACCATCTCTCTCGGAAGCGTCGGGTCAATAACAGTCTAGCGCAAGACCTCGAATAGACGACGCCAAGAGTAAACATC


Protein sequences

Name Description Sequence
Rsa.22215 translated coding region predicted by ESTScan from UniGene Rsa.22215

XCLLLASSIRGLALDCYXPDASERDGDLAEWAMKWQKKGQLDQIVDQSLRGNIRPYSLRKFAETGEKCLADYGVDRPSMGDVLWNLEYALQLQEAVIDGEPEDNSTNMIGELPPQINNFSQGDSSVNVPGTNGRFEESSIDDLSGVSMSKVFSQLVKSKEDDDEIGEAVDNNAHK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF785
28-157 SUBFAMILY NOT NAMED

LAEWAMKWQKKGQLDQIVDQSLRGNIRPYSLRKFAETGEKCLADYGVDRPSMGDVLWNLEYALQLQEAVIDGEPEDNSTNMIGELPPQINNFSQGDSSVNVPGTNGRFEESSIDDLSGVSMSKVFSQLVK

HMMPanther: PTHR24420
28-157 FAMILY NOT NAMED,FAMILY NOT NAMED

LAEWAMKWQKKGQLDQIVDQSLRGNIRPYSLRKFAETGEKCLADYGVDRPSMGDVLWNLEYALQLQEAVIDGEPEDNSTNMIGELPPQINNFSQGDSSVNVPGTNGRFEESSIDDLSGVSMSKVFSQLVK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox