PRGDB00076418 (Sbi.4536)

From PRG Wiki
Jump to: navigation, search
Sbi.4536
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 242072403 (XM_002446093)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Sorghum bicolor

Comment?

Sorghum bicolor hypothetical protein, mRNA

DNA Sequence

AAAAGAACCGATGGCAGCTCTCCTTCTCTTGTCCTTGCTCCTGCTGCTGTCCTCTACTCCCCTTCAAGCTCAACAGAACATCACCTTGAACTCCTCCTTGACACCCCAAGGGCCTAGCACCTCGTGGCTCTCTCCATCCGGCGACTTCGCGTTCGGCTTCCGGCCCATCGAGGGTAACACCTCTTTCTACCTGCTCGCCGTCTGGTTCAACAAGATCGGAGACCAGACAGTGGCTTGGTATGCCAAGACCACTGATTCAGATCCAGCGCCGGTGCAAGTTTCATCCGGTTCACGCCTCCTGCTCAACTCCAATGGGGCGCTCTCGCTCCAGGACTCCACCGGCACAGAGGTATGGAATCCCCAAATTGTGGGTGCATCCTACGCTGCCATGCTCGATTCTGGAAACTTTGTACTGGTTGCTTCAGATGGCTCTACCAAATGGGGGAGCTTCAAAAACCCTACAGATACCATCCTGCCCACTCAGGTGCTCACCACTGGAATGAGTCTCCGCAGTCGGATCATCCCCACCGACTACTCCAATGGCCGCTTCCTCCTTGACCTGCAAAGTACTGGTGTGTCTCTTTATACTGTTGCTGTGCCCTCCGGTCACCAATATGATCCATATTGGTCCATGGATGTGAACACCACAAATCTGGTATTCAATGCGACTGGTGTGATATATATCGGCAACCAAAGTGAAATCACATCTTGGGTCATCAGCTCCATAGCAAACTACTACCTTCGTGCCACACTTGATCCTGATGGTGTTTTCCGACAATATATGTACCCAAAGAAAGCCAGCAACCAGAGTAATCAGGAATGGTCAGTAGTGGACTTCAAGCCCCCAAATATCTGTGATGCACAGCTGACAAATGTTGGAAGCGGTATTTGCGGTTTTAACAGTTATTGCATATGGAGTGGGACAAACAACCTGAGTACTTGCATGTGCCCAGAGCAGTACTCATTTATTGATGACAAGAGGAAGTATATAGGCTGCAAACCAGACTTCGAGCCACAAAGTTGCGACTTGGATGAAGCAGCGGTCATGATGCAGTTTAAGTTGATACCGGTGAGCCATGTTGATTGGCCACTGTCTGACTATGAGCAGTATAGCCCCATTACTGCAGATCAGTGTCAGAAACTCTGTATGACAGATTGTTTCTGTGCCCTTGCTGTGTTCCATGATGAAGACAATACATGTTGGAAGAAGAAGATGCCTTTGTCAAATGGCCATATGGGGGATGATGTGCAGAGGACAGTTTACATCAAGGTACGAAAGAACAATGGTACACAGTCTGAGATCATTGCTTCGAACAAATGGAAGAAAGACAAGAAGAATTGGATCATTGGAAGTTCATTGTTTTTGGGAAGCTCTGTCTTGGTGAACATTCTGCTGATTTCCATAATACTCTTTGGTACTTACTGTACCATCACCATAAAAGAAGTCCCATCTATGCAGTCACCAAACAATATAGGATTGCCCTTGAAAGCCTTCACTTATACTGAGCTTGAGAAGGCAACCGGTGGATTCCAGAAAGTGATTGGCACAGGTGCCTCTGGTATTGTGTACAAGGGCCAGCTACAAGATGATCTCAGTACCCACATTGCTGTCAAAAAAATTGACAAGCTTGAGCATGAAACAGAGAAGGAGTTCACCAGTGAAGTCCAAACTATTGGTCGGACGCACCACAAGAACTTGGTCAGGTTGCTAGGATTCTGCAATGAAGGAAAAGAAAGACTACTAGTGTATGAATTCATGACCAATGGATCACTCAACAGATTCTTATTTGGTGATACCAAGCTTCAGTGGAATATTCGAGCTCAGCTTGCTCTCGGGGTGGCAAGGGGGCTGCTATACTTACATGAGGAATGCAGCACACAGATTATCCATTGTGACATAAAGCCCCAGAACATCCTTCTCGATGGCGACTTCACAGCAAAGATCTCAGATTTCGGCTTAGCCAAACTGCTCCGAACCAACCAGACACAAACAAATACAGGTATTCGGGGTACCCGAGGATATGTTGCCCCTGAGTGGTTTAAGAACATCGGTATCACTGCCAAGGTGGATGTTTACAGCTTTGGGGTCATCCTGTTGGAGCTTGTCTGTTGTCGACGGAATGTTGAATTGGAGGCTGCAGAGGAGGATCAAAAAATACTGACTGACTGGGCAAATGACTGTTATAGGTGTGGCAGAATTGATTTTCTGGTGGAGGGTGATGATGAAGCAATTTCTGATTTGAAGAACGTGGAAAGGTTTGTTGCAGTGGCATTGTGGTGTCTTCAGGAGGACCCAACTATGAGACCTACAATGCGGAAGGTGACACAAATGCTTGATGAAGCAGCTGCAGTCCCAAGCCCTCCTGATCCTACTTCCTTTGTCAGTACACTGGCATAGCATCACTCCTGCATATTGTCATATATTAGTATATGTATGAAGCAATAAAATTGTGTGGGAAATTAGATAC


Protein sequences

Name Description Sequence
Sbi.4536 translated coding region predicted by ESTScan from UniGene Sbi.4536

XKEPMAALLLLSLLLLLSSTPLQAQQNITLNSSLTPQGPSTSWLSPSGDFAFGFRPIEGNTSFYLLAVWFNKIGDQTVAWYAKTTDSDPAPVQVSSGSRLLLNSNGALSLQDSTGTEVWNPQIVGASYAAMLDSGNFVLVASDGSTKWGSFKNPTDTILPTQVLTTGMSLRSRIIPTDYSNGRFLLDLQSTGVSLYTVAVPSGHQYDPYWSMDVNTTNLVFNATGVIYIGNQSEITSWVISSIANYYLRATLDPDGVFRQYMYPKKASNQSNQEWSVVDFKPPNICDAQLTNVGSGICGFNSYCIWSGTNNLSTCMCPEQYSFIDDKRKYIGCKPDFEPQSCDLDEAAVMMQFKLIPVSHVDWPLSDYEQYSPITADQCQKLCMTDCFCALAVFHDEDNTCWKKKMPLSNGHMGDDVQRTVYIKVRKNNGTQSEIIASNKWKKDKKNWIIGSSLFLGSSVLVNILLISIILFGTYCTITIKEVPSMQSPNNIGLPLKAFTYTELEKATGGFQKVIGTGASGIVYKGQLQDDLSTHIAVKKIDKLEHETEKEFTSEVQTIGRTHHKNLVRLLGFCNEGKERLLVYEFMTNGSLNRFLFGDTKLQWNIRAQLALGVARGLLYLHEECSTQIIHCDIKPQNILLDGDFTAKISDFGLAKLLRTNQTQTNTGIRGTRGYVAPEWFKNIGITAKVDVYSFGVILLELVCCRRNVELEAAEEDQKILTDWANDCYRCGRIDFLVEGDDEAISDLKNVERFVAVALWCLQEDPTMRPTMRKVTQMLDEAAAVPSPPDPTSFVSTLA

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF846
5-791 OS04G0201900 PROTEIN

MAALLLLSLLLLLSSTPLQAQQNITLNSSLTPQGPSTSWLSPSGDFAFGFRPIEGNTSFYLLAVWFNKIGDQTVAWYAKTTDSDPAPVQVSSGSRLLLNSNGALSLQDSTGTEVWNPQIVGASYAAMLDSGNFVLVASDGSTKWGSFKNPTDTILPTQVLTTGMSLRSRIIPTDYSNGRFLLDLQSTGVSLYTVAVPSGHQYDPYWSMDVNTTNLVFNATGVIYIGNQSEITSWVISSIANYYLRATLDPDGVFRQYMYPKKASNQSNQEWSVVDFKPPNICDAQLTNVGSGICGFNSYCIWSGTNNLSTCMCPEQYSFIDDKRKYIGCKPDFEPQSCDLDEAAVMMQFKLIPVSHVDWPLSDYEQYSPITADQCQKLCMTDCFCALAVFHDEDNTCWKKKMPLSNGHMGDDVQRTVYIKVRKNNGTQSEIIASNKWKKDKKNWIIGSSLFLGSSVLVNILLISIILFGTYCTITIKEVPSMQSPNNIGLPLKAFTYTELEKATGGFQKVIGTGASGIVYKGQLQDDLSTHIAVKKIDKLEHETEKEFTSEVQTIGRTHHKNLVRLLGFCNEGKERLLVYEFMTNGSLNRFLFGDTKLQWNIRAQLALGVARGLLYLHEECSTQIIHCDIKPQNILLDGDFTAKISDFGLAKLLRTNQTQTNTGIRGTRGYVAPEWFKNIGITAKVDVYSFGVILLELVCCRRNVELEAAEEDQKILTDWANDCYRCGRIDFLVEGDDEAISDLKNVERFVAVALWCLQEDPTMRPTMRKVTQMLDEAAAVPSPPDP

HMMPanther: PTHR24420
5-791 FAMILY NOT NAMED,FAMILY NOT NAMED

MAALLLLSLLLLLSSTPLQAQQNITLNSSLTPQGPSTSWLSPSGDFAFGFRPIEGNTSFYLLAVWFNKIGDQTVAWYAKTTDSDPAPVQVSSGSRLLLNSNGALSLQDSTGTEVWNPQIVGASYAAMLDSGNFVLVASDGSTKWGSFKNPTDTILPTQVLTTGMSLRSRIIPTDYSNGRFLLDLQSTGVSLYTVAVPSGHQYDPYWSMDVNTTNLVFNATGVIYIGNQSEITSWVISSIANYYLRATLDPDGVFRQYMYPKKASNQSNQEWSVVDFKPPNICDAQLTNVGSGICGFNSYCIWSGTNNLSTCMCPEQYSFIDDKRKYIGCKPDFEPQSCDLDEAAVMMQFKLIPVSHVDWPLSDYEQYSPITADQCQKLCMTDCFCALAVFHDEDNTCWKKKMPLSNGHMGDDVQRTVYIKVRKNNGTQSEIIASNKWKKDKKNWIIGSSLFLGSSVLVNILLISIILFGTYCTITIKEVPSMQSPNNIGLPLKAFTYTELEKATGGFQKVIGTGASGIVYKGQLQDDLSTHIAVKKIDKLEHETEKEFTSEVQTIGRTHHKNLVRLLGFCNEGKERLLVYEFMTNGSLNRFLFGDTKLQWNIRAQLALGVARGLLYLHEECSTQIIHCDIKPQNILLDGDFTAKISDFGLAKLLRTNQTQTNTGIRGTRGYVAPEWFKNIGITAKVDVYSFGVILLELVCCRRNVELEAAEEDQKILTDWANDCYRCGRIDFLVEGDDEAISDLKNVERFVAVALWCLQEDPTMRPTMRKVTQMLDEAAAVPSPPDP

Seg: seg
8-19 seg

LLLLSLLLLLSS

ProfileScan: PS50927
IPR001480
19-152 BULB_LECTIN
Bulb-type lectin domain

STPLQAQQNITLNSSLTPQGPSTSWLSPSGDFAFGFRPIEGNTSFYLLAVWFNKIGDQTVAWYAKTTDSDPAPVQVSSGSRLLLNSNGALSLQDSTGTEVWNPQIVGASYAAMLDSGNFVLVASDGSTKWGSFK

HMMSmart: SM00108
IPR001480
30-154 Bulb-type mannose-specific lectin
Bulb-type lectin domain

LNSSLTPQGPSTSWLSPSGDFAFGFRPIEGNTSFYLLAVWFNKIGDQTVAWYAKTTDSDPAPVQVSSGSRLLLNSNGALSLQDSTGTEVWNPQIVGASYAAMLDSGNFVLVASDGSTKWGSFKNP

superfamily: SSF51110
IPR001480
60-212 alpha-D-mannose-specific plant lectins
Bulb-type lectin domain

NTSFYLLAVWFNKIGDQTVAWYAKTTDSDPAPVQVSSGSRLLLNSNGALSLQDSTGTEVWNPQIVGASYAAMLDSGNFVLVASDGSTKWGSFKNPTDTILPTQVLTTGMSLRSRIIPTDYSNGRFLLDLQSTGVSLYTVAVPSGHQYDPYWSM

Gene3D: G3DSA:2.90.10.10
IPR001480
65-213 no description
Bulb-type lectin domain

LLAVWFNKIGDQTVAWYAKTTDSDPAPVQVSSGSRLLLNSNGALSLQDSTGTEVWNPQIVGASYAAMLDSGNFVLVASDGSTKWGSFKNPTDTILPTQVLTTGMSLRSRIIPTDYSNGRFLLDLQSTGVSLYTVAVPSGHQYDPYWSMD

HMMPfam: PF01453
IPR001480
76-166 B_lectin
Bulb-type lectin domain

QTVAWYAKTTDSDPAPVQVSSGSRLLLNSNGALSLQDSTGTEVWNPQIVGASYAAMLDSGNFVLVASDGSTKWGSFKNPTDTILPTQVLTT

Seg: seg
95-110 seg

SSGSRLLLNSNGALSL

Seg: seg
439-450 seg

NKWKKDKKNWII

Seg: seg
451-471 seg

GSSLFLGSSVLVNILLISIIL

superfamily: SSF56112
IPR011009
481-779 Protein kinase-like (PK-like)
Protein kinase-like domain

KEVPSMQSPNNIGLPLKAFTYTELEKATGGFQKVIGTGASGIVYKGQLQDDLSTHIAVKKIDKLEHETEKEFTSEVQTIGRTHHKNLVRLLGFCNEGKERLLVYEFMTNGSLNRFLFGDTKLQWNIRAQLALGVARGLLYLHEECSTQIIHCDIKPQNILLDGDFTAKISDFGLAKLLRTNQTQTNTGIRGTRGYVAPEWFKNIGITAKVDVYSFGVILLELVCCRRNVELEAAEEDQKILTDWANDCYRCGRIDFLVEGDDEAISDLKNVERFVAVALWCLQEDPTMRPTMRKVTQML

Gene3D: G3DSA:3.30.200.20
496-574 no description

LKAFTYTELEKATGGFQKVIGTGASGIVYKGQLQDDLSTHIAVKKIDKLEHETEKEFTSEVQTIGRTHHKNLVRLLGFC

ProfileScan: PS50011
IPR000719
509-783 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

GGFQKVIGTGASGIVYKGQLQDDLSTHIAVKKIDKLEHETEKEFTSEVQTIGRTHHKNLVRLLGFCNEGKERLLVYEFMTNGSLNRFLFGDTKLQWNIRAQLALGVARGLLYLHEECSTQIIHCDIKPQNILLDGDFTAKISDFGLAKLLRTNQTQTNTGIRGTRGYVAPEWFKNIGITAKVDVYSFGVILLELVCCRRNVELEAAEEDQKILTDWANDCYRCGRIDFLVEGDDEAISDLKNVERFVAVALWCLQEDPTMRPTMRKVTQMLDEAA

HMMSmart: SM00220
IPR002290
509-783 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

GGFQKVIGTGASGIVYKGQLQDDLSTHIAVKKIDKLEHETEKEFTSEVQTIGRTHHKNLVRLLGFCNEGKERLLVYEFMTNGSLNRFLFGDTKLQWNIRAQLALGVARGLLYLHEECSTQIIHCDIKPQNILLDGDFTAKISDFGLAKLLRTNQTQTNTGIRGTRGYVAPEWFKNIGITAKVDVYSFGVILLELVCCRRNVELEAAEEDQKILTDWANDCYRCGRIDFLVEGDDEAISDLKNVERFVAVALWCLQEDPTMRPTMRKVTQMLDEAA

HMMSmart: SM00219
IPR020635
511-779 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FQKVIGTGASGIVYKGQLQDDLSTHIAVKKIDKLEHETEKEFTSEVQTIGRTHHKNLVRLLGFCNEGKERLLVYEFMTNGSLNRFLFGDTKLQWNIRAQLALGVARGLLYLHEECSTQIIHCDIKPQNILLDGDFTAKISDFGLAKLLRTNQTQTNTGIRGTRGYVAPEWFKNIGITAKVDVYSFGVILLELVCCRRNVELEAAEEDQKILTDWANDCYRCGRIDFLVEGDDEAISDLKNVERFVAVALWCLQEDPTMRPTMRKVTQML

HMMPfam: PF00069
IPR017442
512-777 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

QKVIGTGASGIVYKGQLQDDLSTHIAVKKIDKLEHETEKEFTSEVQTIGRTHHKNLVRLLGFCNEGKERLLVYEFMTNGSLNRFLFGDTKLQWNIRAQLALGVARGLLYLHEECSTQIIHCDIKPQNILLDGDFTAKISDFGLAKLLRTNQTQTNTGIRGTRGYVAPEWFKNIGITAKVDVYSFGVILLELVCCRRNVELEAAEEDQKILTDWANDCYRCGRIDFLVEGDDEAISDLKNVERFVAVALWCLQEDPTMRPTMRKVTQ

PatternScan: PS00107
IPR017441
515-540 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGTGASGIVYKGQLQDDLSTHIAVKK

Gene3D: G3DSA:1.10.510.10
575-779 no description

NEGKERLLVYEFMTNGSLNRFLFGDTKLQWNIRAQLALGVARGLLYLHEECSTQIIHCDIKPQNILLDGDFTAKISDFGLAKLLRTNQTQTNTGIRGTRGYVAPEWFKNIGITAKVDVYSFGVILLELVCCRRNVELEAAEEDQKILTDWANDCYRCGRIDFLVEGDDEAISDLKNVERFVAVALWCLQEDPTMRPTMRKVTQML

PatternScan: PS00108
IPR008271
629-641 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHCDIKPQNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox