PRGDB00076445 (Sbi.6378)

From PRG Wiki
Jump to: navigation, search
Sbi.6378
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 242071486 (XM_002450975)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Sorghum bicolor

Comment?

Sorghum bicolor hypothetical protein, mRNA

DNA Sequence

ATGGAGGCGACGGCCCTGAGCGTGGGCAAGTCCGTGCTGAATGGAGCGCTTGGCTACGCAAAATCTGCATTTGCCGAGGAGGTGGCCTTGCAGCTCGGTATCCAGAAAGACCACACTTTCGTCGCGGATGAGCTTGAGATGATGAGATCTTTCATGATGGAGGCACACGAGGAGCGAGACAACAACAAGGTGGTCAAGACCTGGGTGAAACAGGTTCGTGACACTGCCTACGACGTCGAGGACAGCCTCCAGGATTTTGCTGTTCGTCTCAAGAGGCCATCCTGCTGGCGGTTCCCTCGCACGCTGCTCGAGCGGCGCCGTATAGCCAAGCAGATGAAGGAGCTCAGAGCCAAGGTTGAGGATGTGAGCCAGAGGAATGTGCGGTACCATCTCATCAAGGGATCCAGCTCCAAGGGTGCCACCACCTCCGCTGACCAATCTGGCCTTACTGCTGCAGCCATATTTGGCATTGATGATGCAAGGCGTGCCGCAAAGCAGGACAATCAGAGAGTGGATCTAGTGCAACTAATCAACAAGGAGGATGAGGACCTTCAAGTGATATCTGTATGGGGGACAAGTGGTGATATGGGCCTAACAACGATAATCAGGGAGGCTTATGACAACCAAGATGTGCAAATCAGATTCCGGTCCCGAGCATGGGTAAGAGTGATGCATCCTTTCAGTCCAAAAGACTTTGTCCAGAGCTTGGTGAATCAGCTTCATGCAACCCAAGGTGTTGAAGCTCTGTTGGAAAAAGAGAAGACAGAACAAGATCTAGCTATGGAATTCAATGGATATGTGAATGGTAGTAGGTTTCTGATCGTGCTTAATAACCTTTCCACCATTGAAGAGTGGGACCAGATTAAGAAATGCTTCCCAAACAACAAGAAAGGAAGCCGGATCATAGTGTCAAGCACACAAGTTGAAGTTGCAAGCTTATGCGCAGGACAAGAAAGCCAAGCCTCAGAGCTAAAGCAACTGTCTGTTGAGCAGACACTTTACGCATTCTACGATAAGGGTTCCCCAAATGGAGAGGATTCAGTGAAGCGAGTGTCTATCTTGGATGTGGCAACCACAAGTATAGACGATCAAATAGCACCTCATGGTGAGATTACAGATGATCAATATATGGATGCTGATGAGAAGAAGGTGGCTAGAAAGAGTCTTAGTCGTACCAGGACGTGTTTGGGTGCTTTGGAGGAATTGCAACTTATCGGACGAAATAGAGAAATATCTGAAATTATAGACTTAGTTTCAAATAATGATAATAGCCAACAGGTTCAAGTGATCTCTGTGTGGGGAATGGGTGGCCTTGGGAAAACCACCCTAGTTGGTGGTGTTTATCAAAGCCCAAAGTTGAGTGACAAGTTTGAGAAGTACGTTTTCATCACAATTATGCGTCCTTTCAGTCTTGAAGAGCTCCTTAGGAGCTTGGCCAGACAACTACATGAAGGATCTTCTAAGAAGCAAGAATTATTAGAAAATAGAATCAACAATAAGAAATCATTTGCATCAATGGAAGTCGACAAGTTGACTGAGGAGTTGAAAAGACTATTAGAGAAGAAAAGTTCTTTGATTGTTCTAGATGACTTCTTTGAGACCTCTGAATGGGACTTGATAAAACCAAGGTTATTACCTCTATTGGAAAAGACAAGCCGAATCATTATCACTACAAGGGAAGAGAATATTGCCAACCACTGCTCAGGAAAACATGGAGTTGTGTGCAACCTTCAAGTTCTTCAGCAAGATGATGCACTTTGCCTCCTGAGTGAAAAGGTATTTGATGACGCTACATATTTGGATGAGCAAAATAATCCCGAGTTGGTTAAAGAAGCAAAACAAATCCTAAAAAAGTGTGGTGGACTTCCTCTTGCAATAGTTGTCATAGGTGGCTTCTTGGCAAACCGTCCAAAGAATGCAGAAGAATGGCGGCAGTTGAATGAGAATATCAACGCAGAGTTAGAGATGAATCCAAAGCTTGGAATGATAAGAACTGTCCTTGAAAAGAGCTATGATGGTTTACCCTACCATCTTAAGTCTTGTTTTTTATATCTGTCCATTTTTCTTGAAGACATGAACATTAGCAGAAGGCGTCTGGTGCGTCGGTGGGCAGCAGAAGGTTACTCAGCTGAGACTCATGGGAAGTCAGCCATTGAAATAGCTGATGACTACTTCGTGCAACTCAAGAACAGAAGCATGATTTTACCATCTCAGCAATCATTTTACAGCAGGAAAACAATTGACTCTTGCAAAGTACATGATCTCATCCGTGACATTGCCATCTCAAAGTCAAGGGAGGAGAACCTAGTCTTCACACTGGAGGAAGGCTGCAGCATGAATATCCATGGCCCAATACGCCATCTTGCTATAAGTAGCAACTGGAATGGAGATAAGAGTGAATTCGAGGGCATAGTGGACGTGTCCCGAATACGATCGCTATCTCTGTTTGGGGAGTGGAAGCCATTTTTTATTTCCGACAAGATGAGGTTTCTACGAGTGCTTGACTTGGAAGGGACTAGTGATCTACAATACCATCACCTTGATCAGATTTGGAAGCTTATTCACCTAAAGTACCTTTCTCTACGAGGATGCTTGGGTATTGATCTACTGTCCGATTCATTGGGCAACCTAAGGCAACTCCAAACACTAGACATCAGAGGTACATATGTAAAGGCTCTGCCAAAAACCATCATCAAACTACAGAACCTACAGTACATCCATGCTGGAAGAAAATCAGATTACCCACAGGGCGAAATTGATAGTTTAATGGAGAGGTGTCTTGGCGGGGCGTTTGATTGTGCGACATGTTGCTTACCTCATCTTTTGAACATTGATGGCCCCAGCTGTAAGGCCCTTACCAGGCGAGATGCATGCACTTTCGCTTGCTGCGTGCAATTCCCTTTAAACGTGACGGGAGCAGATAAAAGAGGTGTTATGGTGCCAAGGGGGATCAGAAAACTTAAAGACATGCACACACTAAGGGAAGTGAATGTCTGGAGAGGAAAGAACGTTCTACAAGACATTGGAAGGCTCACAGGGTTGCGCAAGTTGGGAGTGAATGGCATCAACAAGAAGAATGGCCGTGTGTTTTGCTCGGCCATTTCCAAACTCAGCAGACTAGAATCGCTGTCGGCGAGTTCAGCAGGTTTTTGTGGTTGCTTGGATGAGATATCCTCACCTCCAAAAAACCTGCAGAGCCTCAAGCTGTATGGCAATCTGGAAAAGTTGCCGGTATGGATCATGGAGCTCCAGCATCTGGTGAAGTTGAAACTAGCAGGCCCTAAGCTATTGGAGCACGATGCTGCTATGGAATTCCTTGGCAAACTACCGAGCCTGGAAATTCTAGTTGTGTCAGGGTCATCGTTTCAGTGTGAAGAACTTGATTTCAAATCTCCACAGGGCGGAATAGCATTTGGAATCCTCAGGGTGCTTACGCTTTCAGTGTCAGGAATCAAATCAGTCAAATTTGACGAAGGAGCAATGCCCAAACTGGAGCGGCTGCAGGTCACAGGGGTAACAAACAATGAAATTGTTTTTTCTGGGCTAGGATTTCTCCCAAGCATCAACGAGGTTCAGGTTGGAGTTTACTTTCCTTTGGATTGGGACAGGATAAGGGCCGCTCGGGATCATGAGACTCAGTACAAGATACTTGAGGAAGAAGGCCAGGAAGCAAGGCGCAAGAAAGGTGAGCTCAAGAAGAAAATCCAGGAACAGCTAGCTCAGAATACAAACCAACCCATTGTGACGGTGGGCTGAGTACGTCTGGAACAGCCACAGGCTGATTCGATGATCCGTACAAGGCTGAAGACGATCAGAGCGGGCTGCCTGGGAGCAACAGCCAGGTGGGTCCAAATCCAATATGGTACCTACGTGGGTGCGTACCGTACCAGTGCATGTGCCGCCATTCCCTGATATATATCATATATGTGCTATGCGCATGCATGTTGTTCATTTCTGTTTTCCAAAGGATTGGTGGTGTACGTGTCTGTGCCTGCGCATGTTGTAAACAAGTACTGTATTTGAATACAGCCTCTTCTACCTATTTCTTCTTGGTTTCTGTATTATAAATTGAAGATGCTTTTACGAGACAAGAATCCATTTATGTGGCCCATTCAAATATACTCAAGTGGCCAAAGTTTATTTCCTTTT


Protein sequences

Name Description Sequence
Sbi.6378 translated coding region predicted by ESTScan from UniGene Sbi.6378

MEATALSVGKSVLNGALGYAKSAFAEEVALQLGIQKDHTFVADELEMMRSFMMEAHEERDNNKVVKTWVKQVRDTAYDVEDSLQDFAVRLKRPSCWRFPRTLLERRRIAKQMKELRAKVEDVSQRNVRYHLIKGSSSKGATTSADQSGLTAAAIFGIDDARRAAKQDNQRVDLVQLINKEDEDLQVISVWGTSGDMGLTTIIREAYDNQDVQIRFRSRAWVRVMHPFSPKDFVQSLVNQLHATQGVEALLEKEKTEQDLAMEFNGYVNGSRFLIVLNNLSTIEEWDQIKKCFPNNKKGSRIIVSSTQVEVASLCAGQESQASELKQLSVEQTLYAFYDKGSPNGEDSVKRVSILDVATTSIDDQIAPHGEITDDQYMDADEKKVARKSLSRTRTCLGALEELQLIGRNREISEIIDLVSNNDNSQQVQVISVWGMGGLGKTTLVGGVYQSPKLSDKFEKYVFITIMRPFSLEELLRSLARQLHEGSSKKQELLENRINNKKSFASMEVDKLTEELKRLLEKKSSLIVLDDFFETSEWDLIKPRLLPLLEKTSRIIITTREENIANHCSGKHGVVCNLQVLQQDDALCLLSEKVFDDATYLDEQNNPELVKEAKQILKKCGGLPLAIVVIGGFLANRPKNAEEWRQLNENINAELEMNPKLGMIRTVLEKSYDGLPYHLKSCFLYLSIFLEDMNISRRRLVRRWAAEGYSAETHGKSAIEIADDYFVQLKNRSMILPSQQSFYSRKTIDSCKVHDLIRDIAISKSREENLVFTLEEGCSMNIHGPIRHLAISSNWNGDKSEFEGIVDVSRIRSLSLFGEWKPFFISDKMRFLRVLDLEGTSDLQYHHLDQIWKLIHLKYLSLRGCLGIDLLSDSLGNLRQLQTLDIRGTYVKALPKTIIKLQNLQYIHAGRKSDYPQGEIDSLMERCLGGAFDCATCCLPHLLNIDGPSCKALTRRDACTFACCVQFPLNVTGADKRGVMVPRGIRKLKDMHTLREVNVWRGKNVLQDIGRLTGLRKLGVNGINKKNGRVFCSAISKLSRLESLSASSAGFCGCLDEISSPPKNLQSLKLYGNLEKLPVWIMELQHLVKLKLAGPKLLEHDAAMEFLGKLPSLEILVVSGSSFQCEELDFKSPQGGIAFGILRVLTLSVSGIKSVKFDEGAMPKLERLQVTGVTNNEIVFSGLGFLPSINEVQVGVYFPLDWDRIRAARDHETQYKILEEEGQEARRKKGELKKKIQEQLAQNTNQPIVTVGXVRLEQPQADSMIRTRLKTIRAGCLGATARWVQIQYGTYVGAYRTSACAAIP

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF179
9-1171 OS08G0539400 PROTEIN,OS08G0539400 PROTEIN

GKSVLNGALGYAKSAFAEEVALQLGIQKDHTFVADELEMMRSFMMEAHEERDNNKVVKTWVKQVRDTAYDVEDSLQDFAVRLKRPSCWRFPRTLLERRRIAKQMKELRAKVEDVSQRNVRYHLIKGSSSKGATTSADQSGLTAAAIFGIDDARRAAKQDNQRVDLVQLINKEDEDLQVISVWGTSGDMGLTTIIREAYDNQDVQIRFRSRAWVRVMHPFSPKDFVQSLVNQLHATQGVEALLEKEKTEQDLAMEFNGYVNGSRFLIVLNNLSTIEEWDQIKKCFPNNKKGSRIIVSSTQVEVASLCAGQESQASELKQLSVEQTLYAFYDKGSPNGEDSVKRVSILDVATTSIDDQIAPHGEITDDQYMDADEKKVARKSLSRTRTCLGALEELQLIGRNREISEIIDLVSNNDNSQQVQVISVWGMGGLGKTTLVGGVYQSPKLSDKFEKYVFITIMRPFSLEELLRSLARQLHEGSSKKQELLENRINNKKSFASMEVDKLTEELKRLLEKKSSLIVLDDFFETSEWDLIKPRLLPLLEKTSRIIITTREENIANHCSGKHGVVCNLQVLQQDDALCLLSEKVFDDATYLDEQNNPELVKEAKQILKKCGGLPLAIVVIGGFLANRPKNAEEWRQLNENINAELEMNPKLGMIRTVLEKSYDGLPYHLKSCFLYLSIFLEDMNISRRRLVRRWAAEGYSAETHGKSAIEIADDYFVQLKNRSMILPSQQSFYSRKTIDSCKVHDLIRDIAISKSREENLVFTLEEGCSMNIHGPIRHLAISSNWNGDKSEFEGIVDVSRIRSLSLFGEWKPFFISDKMRFLRVLDLEGTSDLQYHHLDQIWKLIHLKYLSLRGCLGIDLLSDSLGNLRQLQTLDIRGTYVKALPKTIIKLQNLQYIHAGRKSDYPQGEIDSLMERCLGGAFDCATCCLPHLLNIDGPSCKALTRRDACTFACCVQFPLNVTGADKRGVMVPRGIRKLKDMHTLREVNVWRGKNVLQDIGRLTGLRKLGVNGINKKNGRVFCSAISKLSRLESLSASSAGFCGCLDEISSPPKNLQSLKLYGNLEKLPVWIMELQHLVKLKLAGPKLLEHDAAMEFLGKLPSLEILVVSGSSFQCEELDFKSPQGGIAFGILRVLTLSVSGIKSVKFDEGAMPKLERLQVTG

HMMPanther: PTHR23155
9-1171 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GKSVLNGALGYAKSAFAEEVALQLGIQKDHTFVADELEMMRSFMMEAHEERDNNKVVKTWVKQVRDTAYDVEDSLQDFAVRLKRPSCWRFPRTLLERRRIAKQMKELRAKVEDVSQRNVRYHLIKGSSSKGATTSADQSGLTAAAIFGIDDARRAAKQDNQRVDLVQLINKEDEDLQVISVWGTSGDMGLTTIIREAYDNQDVQIRFRSRAWVRVMHPFSPKDFVQSLVNQLHATQGVEALLEKEKTEQDLAMEFNGYVNGSRFLIVLNNLSTIEEWDQIKKCFPNNKKGSRIIVSSTQVEVASLCAGQESQASELKQLSVEQTLYAFYDKGSPNGEDSVKRVSILDVATTSIDDQIAPHGEITDDQYMDADEKKVARKSLSRTRTCLGALEELQLIGRNREISEIIDLVSNNDNSQQVQVISVWGMGGLGKTTLVGGVYQSPKLSDKFEKYVFITIMRPFSLEELLRSLARQLHEGSSKKQELLENRINNKKSFASMEVDKLTEELKRLLEKKSSLIVLDDFFETSEWDLIKPRLLPLLEKTSRIIITTREENIANHCSGKHGVVCNLQVLQQDDALCLLSEKVFDDATYLDEQNNPELVKEAKQILKKCGGLPLAIVVIGGFLANRPKNAEEWRQLNENINAELEMNPKLGMIRTVLEKSYDGLPYHLKSCFLYLSIFLEDMNISRRRLVRRWAAEGYSAETHGKSAIEIADDYFVQLKNRSMILPSQQSFYSRKTIDSCKVHDLIRDIAISKSREENLVFTLEEGCSMNIHGPIRHLAISSNWNGDKSEFEGIVDVSRIRSLSLFGEWKPFFISDKMRFLRVLDLEGTSDLQYHHLDQIWKLIHLKYLSLRGCLGIDLLSDSLGNLRQLQTLDIRGTYVKALPKTIIKLQNLQYIHAGRKSDYPQGEIDSLMERCLGGAFDCATCCLPHLLNIDGPSCKALTRRDACTFACCVQFPLNVTGADKRGVMVPRGIRKLKDMHTLREVNVWRGKNVLQDIGRLTGLRKLGVNGINKKNGRVFCSAISKLSRLESLSASSAGFCGCLDEISSPPKNLQSLKLYGNLEKLPVWIMELQHLVKLKLAGPKLLEHDAAMEFLGKLPSLEILVVSGSSFQCEELDFKSPQGGIAFGILRVLTLSVSGIKSVKFDEGAMPKLERLQVTG

Coil: coil
105-126 coiled-coil

RRRIAKQMKELRAKVEDVSQRN

superfamily: SSF52540
154-346 P-loop containing nucleoside triphosphate hydrolases

IFGIDDARRAAKQDNQRVDLVQLINKEDEDLQVISVWGTSGDMGLTTIIREAYDNQDVQIRFRSRAWVRVMHPFSPKDFVQSLVNQLHATQGVEALLEKEKTEQDLAMEFNGYVNGSRFLIVLNNLSTIEEWDQIKKCFPNNKKGSRIIVSSTQVEVASLCAGQESQASELKQLSVEQTLYAFYDKGSPNGED

HMMPfam: PF00931
IPR002182
174-338 NB-ARC,NBS
NB-ARC

VQLINKEDEDLQVISVWGTSGDMGLTTIIREAYDNQDVQIRFRSRAWVRVMHPFSPKDFVQSLVNQLHATQGVEALLEKEKTEQDLAMEFNGYVNGSRFLIVLNNLSTIEEWDQIKKCFPNNKKGSRIIVSSTQVEVASLCAGQESQASELKQLSVEQTLYAFYD

superfamily: SSF52540
404-650 P-loop containing nucleoside triphosphate hydrolases

LIGRNREISEIIDLVSNNDNSQQVQVISVWGMGGLGKTTLVGGVYQSPKLSDKFEKYVFITIMRPFSLEELLRSLARQLHEGSSKKQELLENRINNKKSFASMEVDKLTEELKRLLEKKSSLIVLDDFFETSEWDLIKPRLLPLLEKTSRIIITTREENIANHCSGKHGVVCNLQVLQQDDALCLLSEKVFDDATYLDEQNNPELVKEAKQILKKCGGLPLAIVVIGGFLANRPKNAEEWRQLNENI

Gene3D: G3DSA:3.40.50.300
405-557 no description

IGRNREISEIIDLVSNNDNSQQVQVISVWGMGGLGKTTLVGGVYQSPKLSDKFEKYVFITIMRPFSLEELLRSLARQLHEGSSKKQELLENRINNKKSFASMEVDKLTEELKRLLEKKSSLIVLDDFFETSEWDLIKPRLLPLLEKTSRIIIT

HMMPfam: PF00931
IPR002182
409-709 NB-ARC,NBS
NB-ARC

REISEIIDLVSNNDNSQQVQVISVWGMGGLGKTTLVGGVYQSPKLSDKFEKYVFITIMRPFSLEELLRSLARQLHEGSSKKQELLENRINNKKSFASMEVDKLTEELKRLLEKKSSLIVLDDFFETSEWDLIKPRLLPLLEKTSRIIITTREENIANHCSGKHGVVCNLQVLQQDDALCLLSEKVFDDATYLDEQNNPELVKEAKQILKKCGGLPLAIVVIGGFLANRPKNAEEWRQLNENINAELEMNPKLGMIRTVLEKSYDGLPYHLKSCFLYLSIFLEDMNISRRRLVRRWAAEGYS

FPrintScan: PR00364
IPR000767
429-444 DISEASERSIST
Disease resistance protein

VISVWGMGGLGKTTLV

Seg: seg
434-447 seg

GMGGLGKTTLVGGV

Coil: coil
475-496 coiled-coil

LRSLARQLHEGSSKKQELLENR

Coil: coil
501-529 coiled-coil

KSFASMEVDKLTEELKRLLEKKSSLIVLD

Seg: seg
510-522 seg

KLTEELKRLLEKK

FPrintScan: PR00364
IPR000767
518-532 DISEASERSIST
Disease resistance protein

LLEKKSSLIVLDDFF

FPrintScan: PR00364
IPR000767
619-633 DISEASERSIST
Disease resistance protein

CGGLPLAIVVIGGFL

superfamily: SSF52047
783-1223 RNI-like,LRR

GPIRHLAISSNWNGDKSEFEGIVDVSRIRSLSLFGEWKPFFISDKMRFLRVLDLEGTSDLQYHHLDQIWKLIHLKYLSLRGCLGIDLLSDSLGNLRQLQTLDIRGTYVKALPKTIIKLQNLQYIHAGRKSDYPQGEIDSLMERCLGGAFDCATCCLPHLLNIDGPSCKALTRRDACTFACCVQFPLNVTGADKRGVMVPRGIRKLKDMHTLREVNVWRGKNVLQDIGRLTGLRKLGVNGINKKNGRVFCSAISKLSRLESLSASSAGFCGCLDEISSPPKNLQSLKLYGNLEKLPVWIMELQHLVKLKLAGPKLLEHDAAMEFLGKLPSLEILVVSGSSFQCEELDFKSPQGGIAFGILRVLTLSVSGIKSVKFDEGAMPKLERLQVTGVTNNEIVFSGLGFLPSINEVQVGVYFPLDWDRIRAARDHETQYKILEEEGQE

Gene3D: G3DSA:3.80.10.10
807-912 no description

VSRIRSLSLFGEWKPFFISDKMRFLRVLDLEGTSDLQYHHLDQIWKLIHLKYLSLRGCLGIDLLSDSLGNLRQLQTLDIRGTYVKALPKTIIKLQNLQYIHAGRKS

FPrintScan: PR00364
IPR000767
826-842 DISEASERSIST
Disease resistance protein

DKMRFLRVLDLEGTSDL

Gene3D: G3DSA:3.80.10.10
986-1191 no description

KLKDMHTLREVNVWRGKNVLQDIGRLTGLRKLGVNGINKKNGRVFCSAISKLSRLESLSASSAGFCGCLDEISSPPKNLQSLKLYGNLEKLPVWIMELQHLVKLKLAGPKLLEHDAAMEFLGKLPSLEILVVSGSSFQCEELDFKSPQGGIAFGILRVLTLSVSGIKSVKFDEGAMPKLERLQVTGVTNNEIVFSGLGFLPSINEV

Seg: seg
1035-1047 seg

SKLSRLESLSASS

Coil: coil
1207-1242 coiled-coil

ARDHETQYKILEEEGQEARRKKGELKKKIQEQLAQN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox