PRGDB00076516 (Sbi.9997)

From PRG Wiki
Jump to: navigation, search
Sbi.9997
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 242070548 (XM_002450506)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Sorghum bicolor

Comment?

Sorghum bicolor hypothetical protein, mRNA

DNA Sequence

AGTCCAGTCGGTCCAGTCCACGGTCCACCCCCTCGACCAAACCCTGGAATCAcgccgccgccccactcgccgcccccgctggtccatccccccttccccaaccccACTCCTGACCTCGAGCGACGGGGATCGACAGCGGGCGCGCGAGCCCGGCCAGCAACCTGATCTGCGGCGAGGGACCACCAGGTGTGAGGCGGCGAGATCGACGACGGGCTCGGTTCGATTCGGCTGAACGCTGAGCACCGGCTTAGCTGAGGCAGGCATCGGCGGCGGAGAGACTTTGCGCGGGGCGGAACGCTGAGGTTATCTTGTATTCTTGTCAAGACAGAACTCTCTTGTCCCTCAGGGCACTGAGCAATCATTGTGATTTATGACTAACTGTTGGTGGTGAAATTATTCAGAAAGTAGAGAACACCACGATGGCTGTTTGGTGCTCTTGTAGTGCTGTTCTCCCAGTACTCTTCTGTTTCATGATCTGTCAGCTTTGCTATGGCACAGTAACTGATATCCAGTGTCTGAAGAAGCTGAAGGCATCAGTTGATCCGGACAATAAGTTAGAATGGACATTCAATAACAACACAGAGGGATCCATATGTGGATTCAATGGTGTCGAGTGCTGGCATCCTAATGAGAACAGGGTTCTTTCACTTCATCTTGGTAGCTTTGGTCTTAAGGGCCAATTCCCTGATGGGCTTGAGAATTGTAGTAGCATGACTTCGTTGGATCTATCAAGCAACAACCTTTCTGGCCCAATCCCAGCTGACATCTCGAAGCGGCTTCCATTCATTACAAACCTTGATCTGTCATATAATAGTTTCTCGGGAGAGATACCAGAAGCACTAGCTAATTGTTCTTATCTCAACATTGTCAGTTTACAACATAACAAATTGACTGGAACAATCCCAGGTCAGCTTGCTGCACTCAATCGCCTAGCCCAGTTTAATGTTGCTGACAATCAATTGTCAGGGCAGATTCCTTCGTCTTTGAGCAAATTTCCAGCCTCCAATTTTGCAAATCAAGACCTTTGTGGGAGGCCTCTAAGCAACGATTGCACTGCTAATTCAAGCAGCCGAACGGGGGTAATTGTTGGTTCTGCTGTTGGTGGTGCAGTTATAACTTTAATAATAGTTGCTGTTATTTTATTCATTGTCCTGCGGAAAATGCCTGCAAAGAAGAAGTTAAAGGATGTAGAAGAAAATAAGTGGGCAAAGACTATTAAGGGAGCAAAAGGAGCAAAGGTTTCCATGTTTGAGAAATCAGTTTCAAAGATGAAGTTGAATGATCTTATGAAAGCAACAGATGATTTTACAAAGGACAATATTATTGGAACTGGTCGATCAGGAACTATGTACAGAGCAACACTTCCAGATGGTTCATTCCTTGCTATCAAGAGGTTGCAGGACACTCAGCATTCAGAGGATCAATTTACATCTGAGATGTCAACACTAGGAAGTGTAAGGCAACGTAACTTAGTGCCACTTTTGGGATATTGCATTGCCAAGAATGAGAGGCTCTTGGTGTATAAGTACATGCCAAAGGGCTCGCTTTATGATAATTTACACCAACAAAACAGTGATAAAAAGGCATTAGAATGGCCATTGAGGCTAAAAATTGCCATTGGGAGTGCTAGAGGATTGGCATGGCTTCATCACAGTTGCAACCCTCGCATTCTTCATAGGAACATTAGTTCCAAGTGCATATTGCTTGACGATGACTATGAACCTAAGATTTCTGATTTTGGTCTGGCAAGGCTTATGAATCCCATTGACACCCACCTGAGCACATTTGTAAATGGTGAGTTTGGTGACTTGGGTTATGTAGCTCCAGAGTATACCCGCACTCTTGTGGCCACTCCAAAAGGGGATGTCTATAGCTTTGGGGTTGTCTTACTTGAACTTGTTACTCGCGAAGAGCCCACACATGTGTCAAATGCGCCAGAGAACTTCAAAGGGAGTTTGGTGGATTGGATAACTTACCTGTCAAACAACTCTATACTTCAGGATGCGATTGACAAGTCTTTGATTGGGAAGGGCAACGATGCTGAGCTGCTTCAATGCATGAAGGTTGCCTGCTCTTGTGTGCTTTCTTCTCCAAAGGAAAGGCCTACAATGTTTGAAGTTTACCAGCTGCTGAGAGCTGTTGGAGAGAAATATCATTTCAGTGCAGCTGATGATGAACTGACAATGCAACCTCAAAATGCCAATCCTGAAGATGAGCTTATTGTAGCAAACTAGTTGAACCTATGTGATGAGTAGGTGCTTGTCAGATACCAAATATTGCCGCAGCTGTTTTAACTTGGAATAATCAGGTCAACTAGAATCATTCTCTATCTTTTATCAGGCAAGCAGTAGGATTTGTCCTTCTGTTGTAAGGTCTATCAATATGTGGTGTTTACATTTGTACATCCTTGCCGTGCTCCTCAGGATTGTCTTCTCCTTGTTGTAAGATGGATCAGCTGTATTGTCAACCAAATTTTAGCTGTAGTGATAGCAATGTGAAACAATGTTGGCCCATCAGTCATGCATCTTCAGCATTGTGGTGCTTTCGTTTAGCATTTCTGTATACTCCTTTCCAAATCGAAATGTTAGACCAGTCTGGACTAGTTTTCAGTAGTGAGAGTTTTATGTCGTAGTTCGAAAAAGTCTGGGACATGCTGGTAGGCACCTGGCAGGGCCGGTGTTTTTGTATATGCACGATGTGGTACTTACATATTATGTTACATGATTTA


Protein sequences

Name Description Sequence
Sbi.9997 translated coding region predicted by ESTScan from UniGene Sbi.9997

SPVGPVHGPPPRPNPGITPPPHSPPPLVHPPFPNPTPDLEXTGIDSGRASPASNLICGEGPPGVRRRDRRRARFDSAERXAPAXLRQASAAERLCAGRNAEVILYSCQDRTLLSLRALSNHCDLXLTVGGEIIQKVENTTMAVWCSCSAVLPVLFCFMICQLCYGTVTDIQCLKKLKASVDPDNKLEWTFNNNTEGSICGFNGVECWHPNENRVLSLHLGSFGLKGQFPDGLENCSSMTSLDLSSNNLSGPIPADISKRLPFITNLDLSYNSFSGEIPEALANCSYLNIVSLQHNKLTGTIPGQLAALNRLAQFNVADNQLSGQIPSSLSKFPASNFANQDLCGRPLSNDCTANSSSRTGVIVGSAVGGAVITLIIVAVILFIVLRKMPAKKKLKDVEENKWAKTIKGAKGAKVSMFEKSVSKMKLNDLMKATDDFTKDNIIGTGRSGTMYRATLPDGSFLAIKRLQDTQHSEDQFTSEMSTLGSVRQRNLVPLLGYCIAKNERLLVYKYMPKGSLYDNLHQQNSDKKALEWPLRLKIAIGSARGLAWLHHSCNPRILHRNISSKCILLDDDYEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEYTRTLVATPKGDVYSFGVVLLELVTREEPTHVSNAPENFKGSLVDWITYLSNNSILQDAIDKSLIGKGNDAELLQCMKVACSCVLSSPKERPTMFEVYQLLRAVGEKYHFSAADDELTMQPQNANPEDELIVAN

Domains

Domain Start-End Description Sequence

Seg: seg
2-37 seg

PVGPVHGPPPRPNPGITPPPHSPPPLVHPPFPNPTP

Seg: seg
65-91 seg

RRRDRRRARFDSAERXAPAXLRQASAA

HMMPanther: PTHR24420:SF477
132-744 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

IIQKVENTTMAVWCSCSAVLPVLFCFMICQLCYGTVTDIQCLKKLKASVDPDNKLEWTFNNNTEGSICGFNGVECWHPNENRVLSLHLGSFGLKGQFPDGLENCSSMTSLDLSSNNLSGPIPADISKRLPFITNLDLSYNSFSGEIPEALANCSYLNIVSLQHNKLTGTIPGQLAALNRLAQFNVADNQLSGQIPSSLSKFPASNFANQDLCGRPLSNDCTANSSSRTGVIVGSAVGGAVITLIIVAVILFIVLRKMPAKKKLKDVEENKWAKTIKGAKGAKVSMFEKSVSKMKLNDLMKATDDFTKDNIIGTGRSGTMYRATLPDGSFLAIKRLQDTQHSEDQFTSEMSTLGSVRQRNLVPLLGYCIAKNERLLVYKYMPKGSLYDNLHQQNSDKKALEWPLRLKIAIGSARGLAWLHHSCNPRILHRNISSKCILLDDDYEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEYTRTLVATPKGDVYSFGVVLLELVTREEPTHVSNAPENFKGSLVDWITYLSNNSILQDAIDKSLIGKGNDAELLQCMKVACSCVLSSPKERPTMFEVYQLLRAVGEKYHFSAADDELTMQPQNANPEDELIVAN

HMMPanther: PTHR24420
132-744 FAMILY NOT NAMED,FAMILY NOT NAMED

IIQKVENTTMAVWCSCSAVLPVLFCFMICQLCYGTVTDIQCLKKLKASVDPDNKLEWTFNNNTEGSICGFNGVECWHPNENRVLSLHLGSFGLKGQFPDGLENCSSMTSLDLSSNNLSGPIPADISKRLPFITNLDLSYNSFSGEIPEALANCSYLNIVSLQHNKLTGTIPGQLAALNRLAQFNVADNQLSGQIPSSLSKFPASNFANQDLCGRPLSNDCTANSSSRTGVIVGSAVGGAVITLIIVAVILFIVLRKMPAKKKLKDVEENKWAKTIKGAKGAKVSMFEKSVSKMKLNDLMKATDDFTKDNIIGTGRSGTMYRATLPDGSFLAIKRLQDTQHSEDQFTSEMSTLGSVRQRNLVPLLGYCIAKNERLLVYKYMPKGSLYDNLHQQNSDKKALEWPLRLKIAIGSARGLAWLHHSCNPRILHRNISSKCILLDDDYEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEYTRTLVATPKGDVYSFGVVLLELVTREEPTHVSNAPENFKGSLVDWITYLSNNSILQDAIDKSLIGKGNDAELLQCMKVACSCVLSSPKERPTMFEVYQLLRAVGEKYHFSAADDELTMQPQNANPEDELIVAN

superfamily: SSF52058
163-333 L domain-like,LRR

CYGTVTDIQCLKKLKASVDPDNKLEWTFNNNTEGSICGFNGVECWHPNENRVLSLHLGSFGLKGQFPDGLENCSSMTSLDLSSNNLSGPIPADISKRLPFITNLDLSYNSFSGEIPEALANCSYLNIVSLQHNKLTGTIPGQLAALNRLAQFNVADNQLSGQIPSSLSKFP

Gene3D: G3DSA:3.80.10.10
181-339 no description

DPDNKLEWTFNNNTEGSICGFNGVECWHPNENRVLSLHLGSFGLKGQFPDGLENCSSMTSLDLSSNNLSGPIPADISKRLPFITNLDLSYNSFSGEIPEALANCSYLNIVSLQHNKLTGTIPGQLAALNRLAQFNVADNQLSGQIPSSLSKFPASNFAN

HMMPfam: PF13516
235-257 LRR_6,Leucine Rich repeat

CSSMTSLDLSSNNLSGPIPADIS

HMMPfam: PF13516
260-283 LRR_6,Leucine Rich repeat

LPFITNLDLSYNSFSGEIPEALAN

Seg: seg
360-385 seg

GVIVGSAVGGAVITLIIVAVILFIVL

superfamily: SSF56112
IPR011009
406-711 Protein kinase-like (PK-like)
Protein kinase-like domain

IKGAKGAKVSMFEKSVSKMKLNDLMKATDDFTKDNIIGTGRSGTMYRATLPDGSFLAIKRLQDTQHSEDQFTSEMSTLGSVRQRNLVPLLGYCIAKNERLLVYKYMPKGSLYDNLHQQNSDKKALEWPLRLKIAIGSARGLAWLHHSCNPRILHRNISSKCILLDDDYEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEYTRTLVATPKGDVYSFGVVLLELVTREEPTHVSNAPENFKGSLVDWITYLSNNSILQDAIDKSLIGKGNDAELLQCMKVACSCVLSSPKERPTMFEVYQLL

Gene3D: G3DSA:3.30.200.20
417-510 no description

FEKSVSKMKLNDLMKATDDFTKDNIIGTGRSGTMYRATLPDGSFLAIKRLQDTQHSEDQFTSEMSTLGSVRQRNLVPLLGYCIAKNERLLVYKY

ProfileScan: PS50011
IPR000719
436-711 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FTKDNIIGTGRSGTMYRATLPDGSFLAIKRLQDTQHSEDQFTSEMSTLGSVRQRNLVPLLGYCIAKNERLLVYKYMPKGSLYDNLHQQNSDKKALEWPLRLKIAIGSARGLAWLHHSCNPRILHRNISSKCILLDDDYEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEYTRTLVATPKGDVYSFGVVLLELVTREEPTHVSNAPENFKGSLVDWITYLSNNSILQDAIDKSLIGKGNDAELLQCMKVACSCVLSSPKERPTMFEVYQLL

HMMSmart: SM00220
IPR002290
436-714 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FTKDNIIGTGRSGTMYRATLPDGSFLAIKRLQDTQHSEDQFTSEMSTLGSVRQRNLVPLLGYCIAKNERLLVYKYMPKGSLYDNLHQQNSDKKALEWPLRLKIAIGSARGLAWLHHSCNPRILHRNISSKCILLDDDYEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEYTRTLVATPKGDVYSFGVVLLELVTREEPTHVSNAPENFKGSLVDWITYLSNNSILQDAIDKSLIGKGNDAELLQCMKVACSCVLSSPKERPTMFEVYQLLRAV

HMMSmart: SM00219
IPR020635
436-711 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FTKDNIIGTGRSGTMYRATLPDGSFLAIKRLQDTQHSEDQFTSEMSTLGSVRQRNLVPLLGYCIAKNERLLVYKYMPKGSLYDNLHQQNSDKKALEWPLRLKIAIGSARGLAWLHHSCNPRILHRNISSKCILLDDDYEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEYTRTLVATPKGDVYSFGVVLLELVTREEPTHVSNAPENFKGSLVDWITYLSNNSILQDAIDKSLIGKGNDAELLQCMKVACSCVLSSPKERPTMFEVYQLL

HMMPfam: PF07714
IPR001245
438-710 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

KDNIIGTGRSGTMYRATLPDGSFLAIKRLQDTQHSEDQFTSEMSTLGSVRQRNLVPLLGYCIAKNERLLVYKYMPKGSLYDNLHQQNSDKKALEWPLRLKIAIGSARGLAWLHHSCNPRILHRNISSKCILLDDDYEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEYTRTLVATPKGDVYSFGVVLLELVTREEPTHVSNAPENFKGSLVDWITYLSNNSILQDAIDKSLIGKGNDAELLQCMKVACSCVLSSPKERPTMFEVYQL

Gene3D: G3DSA:1.10.510.10
511-719 no description

MPKGSLYDNLHQQNSDKKALEWPLRLKIAIGSARGLAWLHHSCNPRILHRNISSKCILLDDDYEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEYTRTLVATPKGDVYSFGVVLLELVTREEPTHVSNAPENFKGSLVDWITYLSNNSILQDAIDKSLIGKGNDAELLQCMKVACSCVLSSPKERPTMFEVYQLLRAVGEKYH






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox