PRGDB00076520 (Sbi.10076)

From PRG Wiki
Jump to: navigation, search
Sbi.10076
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 242071042 (XM_002450753)
Gene Class Unknown
Domain Type LRR
Gene Species Sorghum bicolor

Comment?

Sorghum bicolor hypothetical protein, mRNA

DNA Sequence

ATGCAAAGCCTGGCTCAACATTTCAGTGTGCCAAGAACTTCTAAGGTTCGCATCGCAGCAATGGCAACTCCTCGGTTTGCGAAGGCCACAGCAGTCCTCAGCTGCCTTGTTGCTCTTGCAACACTTGCAAGCTGCAACACTGAAGTTGACATACTGTACGAGCAAAGGCAGACATGGAAGGACCCAAACGATGTGCTGGTGAGCTGGGATCCGACTCTTGTCAATCCCTGCACCTGGCTCCATATCACTTGCAACAACGACAACTCTGTCATCCGTGTGGATTTGGGGAACGCAGGTCTATCAGGCTATCTGGTTCCAGATCTGGGAGGACTGAAGAACCTCCAGTACCTGAACTTGTATGGGAATAACCTGACAGGGTCTATACCTGAATCTTTGGGCAATCTGACGCGTCTTGAGGGGCTGGAGCTTCAGAAGAATGCGCTGAGCGGTGCAATTCCATCCTCACTCGGGAACATCAAAACATTGCAGTTCCTGAAGCTGAACGCGAACATACTGACCGGCACGGTTCCATTGGAAGTCCTCTCTCTTGTCATTGCTGGGAATCTGACCGAGCTAAATATTGCAAACAACGACTTGGCCGGCACAGTCAGATCATCTGGTTTGAGAGTGACTGCAATCATTCAGGACAAGCTGAAGACTGCATGATGATGAGTCCCTGGATCAGGACATTGGCTTTCTTCATGTGTATATTGGCAAGAAATAAAAAGGATAAATCCAATGACATGGATTGATCTAGACATCTTGTAGTATGATATGGCTGCTGAATATATTATATTCTTCTCAGATTGTCCCCTTGAGTAGCATTAGTTAATGAGAATATATGGGGCATCTCTAGTCCTCGAGaaaaaaaaTAAGTCTTCCCAATTTTCCTAGCATTGTAGAAGGTACTGTTAATATATGTAATGCGAAAGTTGTGGTCGTTAACTATAAGTTGATAATGCAAAAGGTGTGGTTAC


Protein sequences

Name Description Sequence
Sbi.10076 translated coding region predicted by ESTScan from UniGene Sbi.10076

MQSLAQHFSVPRTSKVRIAAMATPRFAKATAVLSCLVALATLASCNTEVDILYEQRQTWKDPNDVLVSWDPTLVNPCTWLHITCNNDNSVIRVDLGNAGLSGYLVPDLGGLKNLQYLNLYGNNLTGSIPESLGNLTRLEGLELQKNALSGAIPSSLGNIKTLQFLKLNANILTGTVPLEVLSLVIAGNLTELNIANNDLAGTVRSSGLRVTAIIQDKLKTA


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF610
8-214 PTHR24420:SF610

FSVPRTSKVRIAAMATPRFAKATAVLSCLVALATLASCNTEVDILYEQRQTWKDPNDVLVSWDPTLVNPCTWLHITCNNDNSVIRVDLGNAGLSGYLVPDLGGLKNLQYLNLYGNNLTGSIPESLGNLTRLEGLELQKNALSGAIPSSLGNIKTLQFLKLNANILTGTVPLEVLSLVIAGNLTELNIANNDLAGTVRSSGLRVTAII

HMMPanther: PTHR24420
8-214 PTHR24420,FAMILY NOT NAMED

FSVPRTSKVRIAAMATPRFAKATAVLSCLVALATLASCNTEVDILYEQRQTWKDPNDVLVSWDPTLVNPCTWLHITCNNDNSVIRVDLGNAGLSGYLVPDLGGLKNLQYLNLYGNNLTGSIPESLGNLTRLEGLELQKNALSGAIPSSLGNIKTLQFLKLNANILTGTVPLEVLSLVIAGNLTELNIANNDLAGTVRSSGLRVTAII

superfamily: SSF52058
42-201 SSF52058,LRR

LASCNTEVDILYEQRQTWKDPNDVLVSWDPTLVNPCTWLHITCNNDNSVIRVDLGNAGLSGYLVPDLGGLKNLQYLNLYGNNLTGSIPESLGNLTRLEGLELQKNALSGAIPSSLGNIKTLQFLKLNANILTGTVPLEVLSLVIAGNLTELNIANNDLAG

HMMPfam: PF08263
IPR013210
46-85 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

NTEVDILYEQRQTWKDPNDVLVSWDPTLVNPCTWLHITCN

Gene3D: G3DSA:3.80.10.10
48-205 G3DSA:3.80.10.10

EVDILYEQRQTWKDPNDVLVSWDPTLVNPCTWLHITCNNDNSVIRVDLGNAGLSGYLVPDLGGLKNLQYLNLYGNNLTGSIPESLGNLTRLEGLELQKNALSGAIPSSLGNIKTLQFLKLNANILTGTVPLEVLSLVIAGNLTELNIANNDLAGTVRS

HMMPfam: PF12799
112-149 LRR_4,Leucine Rich repeats (2 copies)

KNLQYLNLYGNNLTGSIPESLGNLTRLEGLELQKNALS

ProfileScan: PS51450
IPR001611
113-136 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQYLNLYGNNLTGSIPESLGNLT

ProfileScan: PS51450
IPR001611
161-182 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

TLQFLKLNANILTGTVPLEVLS

HMMPfam: PF13504
187-199 LRR_7,Leucine rich repeat

GNLTELNIANNDL

ProfileScan: PS51450
IPR001611
188-209 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLTELNIANNDLAGTVRSSGLR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox