PRGDB00076559 (Sbi.12296)

From PRG Wiki
Jump to: navigation, search
Sbi.12296
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 242070688 (XM_002450576)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Sorghum bicolor

Comment?

Sorghum bicolor hypothetical protein, mRNA

DNA Sequence

CCAGAtccgcgctctcccactccagtgtccagtccattccctccctccctccctcccGCACCCACCAATCTCTAGAGCTTTACCACTACGGCCTACGGGGCTCCGGCGGTTCAGCCTACAGGAGACCAGCAAGGCAGCAATTGCGACGTCCCCGCGCAGGTTCATCCAAGAACTGAACTAATGGCAGAAGCACTGCTATCTGCTCTCTCGAAAATTGGTACCGTTTTAGGAGATGAAGTCATCAAATTCGTCATTGCTGAAGCATCTAAAAAGGCAACTAATCTTAGGGAGCTACCAAAAAATATAAGGCACATTGAGAGAGAATTGAATATGATGAGAAATGTCATACGAGATTTGGATACCACAAATCTCAGCATCAATGTGGTCAAGGGTTGGATCGGGGAGCTGAGAAAGGTGGCCTTCCATGTGGAAGATGTAATGGACAAATACTCATATAACGCTTTTAAGCTGCAGGAAGAAGGATCGCTGATGTGGTTCATCAAAGGAGCACATAATGCCAAAATTTTCAGTGATATTGCTGATGAGGTGGTTCGTATAAAGGGTGAGATTGAGCAAGTAAAACAACTGCAGAAGAACTATTTCCCTGCTCTCCAAGTTCCAGCAGGCCCTGTAATTGTTCGACATGGATCCCAAACCTTCTTGCCAGAGCTTATTCAAGATGAAGATCTCGTGGGGATTGCACTGAATCAAGCAAAGCTGATTGGATGGCTTCATAGCAATGAACCAAACAACACAGTGATAACGGTGTCGGGTATGGGTGGATTGGGAAAAACCACTCTAGTCATGAATGTTTATGAGCGTATGAAGAGCGAATTCCCTGTTAGTGCCCGGATCACAGTGTCACAGACCTACACAATAGATGGTTTGCTGAGAGAACTACTCAGAGAGATTGGGAAGGACACATATAAGCAATCAGGTACCATCGAAAGTATGGATGCCTACAAGCTGAGAGAAGAAATTAAGAATGTCCTAGGTACCAGAAAATGTTTGTTTGTCTTGGATGATGTTTGGAACAAGGAGGTGTACCATCAAATGATGGAAGACATTTTCAATACTCTTCGAGCAAGCCGTATCATCATCACAACACGGAGAGAAGACGTTGCATCTCTTGCATCTTCGGGATGCCATCTTCAGCTCCAGCCTTTGGGAAGTTCCTATGCACTCGACCTCTTTTGTAGAAGAGCCTTTAATAACACAGCTGACCGAAAGTGCCCCCAAGAGCTTGAGGATGTGGCTGTTTCCATAGTAGAAAGGTGTAAGGGCCTGCCATTGGCAATTATATCTATGGGCAGCCTCATGTCCTCCAAGAAACCAACTAAACATGCCTGGAATCAAATGTATAATCAGTTCCGGGTTGAGCTAGCAAAACCAGACAATGTGCAGACAATTTTGAAGCTTAGCTACAACGATTTACCAGGGAACCTCAGAAACTGTTTCCTATACTGCAGCCTATTTCCTGAAGATTTCATCATGTCAAGAGAGAGCCTTGTCAGGCAGTGGGTTGCTGAAGGATTTGCAGTGACCAACGAAAACAACACACTGGAGGATGTGGCTGAACTAATTCTGGTGGAGCTCATTACTAGGAACTTGCTGCAAGTTGAAGAGTATGATGAGCTTGGTAGGGTGAACACATGTAAGATGCATGACATTGTGCGTGACCTGGCTCTTTCAATAGCTAGAGATGAAAAGTTTGGCTCTGCAAGCGATCAGGCTGCAGTGATAAATATGGACCGGGAAGTGCGCCGACTATCATTGTGTGGATGGAATGGCAGTGATGCACCAAGACTGAAATTTCCACACCTTCGCACTCTATTTTCACTTGATGGTGTCACATCGACTCGCATGCTAGCCTCAATCTTTTCTGAGTCAAGCTACCTTACTGTTCTTGAGCTACAAGATTCTGAGATAACTGAAGTGCCACAATCTATAGGGAATCTGTTTAATCTACGTTACATTGGCTTGCGGCGGACAGAAGTCAAGTCACTCCCGGAGTGTATTGAGAAGCTATCCAACCTAGAGACACTGGACATCAAGCAAACAAAAATAGAGAAGCTACCAAGAGGCATAGTCAAGGTCAAGAAGCTGCGGCATCTGTTAGCTGACAGAGTGGTGGATGAGAAGCAGAAAGATTTCCGGTACTTCACAGGGGTACAGCCACCCAAGGATCTCTCTAACTTGGTGGAACTTCAGACTCTGGAGACTGTGGAAGCAACAAATGACTTGGCAGGCCAACTGGACAACCTCAGAAAACTAAAAAGTGTGTGGGTTTGCAAAGTTACTGCCATCCATTGTGCAGATCTTTTTTCTGCAGTATCTAAGCTGCCACTTCTTGCCTGTTTGCTTCTTAATGCAAGTGATGAGGAGCAGACACTGCACTTGGAAACTCTCAACCCACAGTCCAAGCAGTTCCACAGGTTGATCGTCAGGGGCCGCTGGGCTGCCGGAACACTGCAGTGCCCAATATTTCAAGGCCATGGGAAAAACCTCAAGTATCTAGCTCTAAGTTGGTCTGGTCTTCATGAAGACCCGCTACTGCTTATTGCTCCACATGTACCAAACCTCACCTATCTGAGTCTTAACAGGGTGAGCAGCACAGAGACAATGGTTATTTCTGAAGGGTCCTTTCCACAGCTGAAGACACTAATACTGAAGAACATGCTCAATGTCAACCAGTTGACAGTTGGGAAGGATGCTCTCCCAAATATTGAAGGTTTATATCTTGTGGCGCTACCGAAACTGAATAAGGTTCCTCAAGGATTTGAATCCCTTGTGTCTTTAAGGAAGCTGTGGTTACTGTCTCTGCATAAGGATTTCAAATTCCTTTGGGAGCTAAGTAGAATGCACCAGAAGATGCCACATGTGGTGGAGGTTCGCGTCGAGTGATCGCCTGCTTCTTCATGCAACAATACTTTTGAATATTTATGCGTATAGTCCTTTGTCTTTGATTCTTCCAGTAGATCTGCAATTCTGAATGATTTTGTGGCTTGTGTTTTTCTTTTCAATAAGTCCGGAAGAAACAGATCTCCTCACCAAGAATGTGCCTGATAGTTGTGTTGTGTGTATGCCATGTTATTGTGGTTTCTTTGTAGTTTGAACTTCTTCATAGTGAACGGGTGACGACT


Protein sequences

Name Description Sequence
Sbi.12296 translated coding region predicted by ESTScan from UniGene Sbi.12296

PDPRSPTPVSSPFPPSLPPAPTNLXSFTTTAYGAPAVQPTGDQQGSNCDVPAQVHPRTELMAEALLSALSKIGTVLGDEVIKFVIAEASKKATNLRELPKNIRHIERELNMMRNVIRDLDTTNLSINVVKGWIGELRKVAFHVEDVMDKYSYNAFKLQEEGSLMWFIKGAHNAKIFSDIADEVVRIKGEIEQVKQLQKNYFPALQVPAGPVIVRHGSQTFLPELIQDEDLVGIALNQAKLIGWLHSNEPNNTVITVSGMGGLGKTTLVMNVYERMKSEFPVSARITVSQTYTIDGLLRELLREIGKDTYKQSGTIESMDAYKLREEIKNVLGTRKCLFVLDDVWNKEVYHQMMEDIFNTLRASRIIITTRREDVASLASSGCHLQLQPLGSSYALDLFCRRAFNNTADRKCPQELEDVAVSIVERCKGLPLAIISMGSLMSSKKPTKHAWNQMYNQFRVELAKPDNVQTILKLSYNDLPGNLRNCFLYCSLFPEDFIMSRESLVRQWVAEGFAVTNENNTLEDVAELILVELITRNLLQVEEYDELGRVNTCKMHDIVRDLALSIARDEKFGSASDQAAVINMDREVRRLSLCGWNGSDAPRLKFPHLRTLFSLDGVTSTRMLASIFSESSYLTVLELQDSEITEVPQSIGNLFNLRYIGLRRTEVKSLPECIEKLSNLETLDIKQTKIEKLPRGIVKVKKLRHLLADRVVDEKQKDFRYFTGVQPPKDLSNLVELQTLETVEATNDLAGQLDNLRKLKSVWVCKVTAIHCADLFSAVSKLPLLACLLLNASDEEQTLHLETLNPQSKQFHRLIVRGRWAAGTLQCPIFQGHGKNLKYLALSWSGLHEDPLLLIAPHVPNLTYLSLNRVSSTETMVISEGSFPQLKTLILKNMLNVNQLTVGKDALPNIEGLYLVALPKLNKVPQGFESLVSLRKLWLLSLHKDFKFLWELSRMHQKMPHVVEVRVE

Domains

Domain Start-End Description Sequence

Seg: seg
3-21 seg

PRSPTPVSSPFPPSLPPAP

Seg: seg
59-70 seg

ELMAEALLSALS

HMMPanther: PTHR23155:SF199
70-961 OS11G0229500 PROTEIN,OS11G0229500 PROTEIN

SKIGTVLGDEVIKFVIAEASKKATNLRELPKNIRHIERELNMMRNVIRDLDTTNLSINVVKGWIGELRKVAFHVEDVMDKYSYNAFKLQEEGSLMWFIKGAHNAKIFSDIADEVVRIKGEIEQVKQLQKNYFPALQVPAGPVIVRHGSQTFLPELIQDEDLVGIALNQAKLIGWLHSNEPNNTVITVSGMGGLGKTTLVMNVYERMKSEFPVSARITVSQTYTIDGLLRELLREIGKDTYKQSGTIESMDAYKLREEIKNVLGTRKCLFVLDDVWNKEVYHQMMEDIFNTLRASRIIITTRREDVASLASSGCHLQLQPLGSSYALDLFCRRAFNNTADRKCPQELEDVAVSIVERCKGLPLAIISMGSLMSSKKPTKHAWNQMYNQFRVELAKPDNVQTILKLSYNDLPGNLRNCFLYCSLFPEDFIMSRESLVRQWVAEGFAVTNENNTLEDVAELILVELITRNLLQVEEYDELGRVNTCKMHDIVRDLALSIARDEKFGSASDQAAVINMDREVRRLSLCGWNGSDAPRLKFPHLRTLFSLDGVTSTRMLASIFSESSYLTVLELQDSEITEVPQSIGNLFNLRYIGLRRTEVKSLPECIEKLSNLETLDIKQTKIEKLPRGIVKVKKLRHLLADRVVDEKQKDFRYFTGVQPPKDLSNLVELQTLETVEATNDLAGQLDNLRKLKSVWVCKVTAIHCADLFSAVSKLPLLACLLLNASDEEQTLHLETLNPQSKQFHRLIVRGRWAAGTLQCPIFQGHGKNLKYLALSWSGLHEDPLLLIAPHVPNLTYLSLNRVSSTETMVISEGSFPQLKTLILKNMLNVNQLTVGKDALPNIEGLYLVALPKLNKVPQGFESLVSLRKLWLLSLHKDFKFLWELSRMHQKMPHV

HMMPanther: PTHR23155
70-961 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

SKIGTVLGDEVIKFVIAEASKKATNLRELPKNIRHIERELNMMRNVIRDLDTTNLSINVVKGWIGELRKVAFHVEDVMDKYSYNAFKLQEEGSLMWFIKGAHNAKIFSDIADEVVRIKGEIEQVKQLQKNYFPALQVPAGPVIVRHGSQTFLPELIQDEDLVGIALNQAKLIGWLHSNEPNNTVITVSGMGGLGKTTLVMNVYERMKSEFPVSARITVSQTYTIDGLLRELLREIGKDTYKQSGTIESMDAYKLREEIKNVLGTRKCLFVLDDVWNKEVYHQMMEDIFNTLRASRIIITTRREDVASLASSGCHLQLQPLGSSYALDLFCRRAFNNTADRKCPQELEDVAVSIVERCKGLPLAIISMGSLMSSKKPTKHAWNQMYNQFRVELAKPDNVQTILKLSYNDLPGNLRNCFLYCSLFPEDFIMSRESLVRQWVAEGFAVTNENNTLEDVAELILVELITRNLLQVEEYDELGRVNTCKMHDIVRDLALSIARDEKFGSASDQAAVINMDREVRRLSLCGWNGSDAPRLKFPHLRTLFSLDGVTSTRMLASIFSESSYLTVLELQDSEITEVPQSIGNLFNLRYIGLRRTEVKSLPECIEKLSNLETLDIKQTKIEKLPRGIVKVKKLRHLLADRVVDEKQKDFRYFTGVQPPKDLSNLVELQTLETVEATNDLAGQLDNLRKLKSVWVCKVTAIHCADLFSAVSKLPLLACLLLNASDEEQTLHLETLNPQSKQFHRLIVRGRWAAGTLQCPIFQGHGKNLKYLALSWSGLHEDPLLLIAPHVPNLTYLSLNRVSSTETMVISEGSFPQLKTLILKNMLNVNQLTVGKDALPNIEGLYLVALPKLNKVPQGFESLVSLRKLWLLSLHKDFKFLWELSRMHQKMPHV

superfamily: SSF52540
213-463 P-loop containing nucleoside triphosphate hydrolases

VRHGSQTFLPELIQDEDLVGIALNQAKLIGWLHSNEPNNTVITVSGMGGLGKTTLVMNVYERMKSEFPVSARITVSQTYTIDGLLRELLREIGKDTYKQSGTIESMDAYKLREEIKNVLGTRKCLFVLDDVWNKEVYHQMMEDIFNTLRASRIIITTRREDVASLASSGCHLQLQPLGSSYALDLFCRRAFNNTADRKCPQELEDVAVSIVERCKGLPLAIISMGSLMSSKKPTKHAWNQMYNQFRVELAK

HMMPfam: PF00931
IPR002182
239-514 NB-ARC,NBS
NB-ARC

KLIGWLHSNEPNNTVITVSGMGGLGKTTLVMNVYERMKSEFPVSARITVSQTYTIDGLLRELLREIGKDTYKQSGTIESMDAYKLREEIKNVLGTRKCLFVLDDVWNKEVYHQMMEDIFNTLRASRIIITTRREDVASLASSGCHLQLQPLGSSYALDLFCRRAFNNTADRKCPQELEDVAVSIVERCKGLPLAIISMGSLMSSKKPTKHAWNQMYNQFRVELAKPDNVQTILKLSYNDLPGNLRNCFLYCSLFPEDFIMSRESLVRQWVAEGFAV

Gene3D: G3DSA:3.40.50.300
242-376 no description

GWLHSNEPNNTVITVSGMGGLGKTTLVMNVYERMKSEFPVSARITVSQTYTIDGLLRELLREIGKDTYKQSGTIESMDAYKLREEIKNVLGTRKCLFVLDDVWNKEVYHQMMEDIFNTLRASRIIITTRREDVAS

FPrintScan: PR00364
IPR000767
253-268 DISEASERSIST
Disease resistance protein

VITVSGMGGLGKTTLV

FPrintScan: PR00364
IPR000767
330-344 DISEASERSIST
Disease resistance protein

VLGTRKCLFVLDDVW

FPrintScan: PR00364
IPR000767
426-440 DISEASERSIST
Disease resistance protein

CKGLPLAIISMGSLM

superfamily: SSF52058
553-956 L domain-like,LRR

KMHDIVRDLALSIARDEKFGSASDQAAVINMDREVRRLSLCGWNGSDAPRLKFPHLRTLFSLDGVTSTRMLASIFSESSYLTVLELQDSEITEVPQSIGNLFNLRYIGLRRTEVKSLPECIEKLSNLETLDIKQTKIEKLPRGIVKVKKLRHLLADRVVDEKQKDFRYFTGVQPPKDLSNLVELQTLETVEATNDLAGQLDNLRKLKSVWVCKVTAIHCADLFSAVSKLPLLACLLLNASDEEQTLHLETLNPQSKQFHRLIVRGRWAAGTLQCPIFQGHGKNLKYLALSWSGLHEDPLLLIAPHVPNLTYLSLNRVSSTETMVISEGSFPQLKTLILKNMLNVNQLTVGKDALPNIEGLYLVALPKLNKVPQGFESLVSLRKLWLLSLHKDFKFLWELSRMHQ

Gene3D: G3DSA:3.80.10.10
585-744 no description

REVRRLSLCGWNGSDAPRLKFPHLRTLFSLDGVTSTRMLASIFSESSYLTVLELQDSEITEVPQSIGNLFNLRYIGLRRTEVKSLPECIEKLSNLETLDIKQTKIEKLPRGIVKVKKLRHLLADRVVDEKQKDFRYFTGVQPPKDLSNLVELQTLETVEA

FPrintScan: PR00364
IPR000767
674-690 DISEASERSIST
Disease resistance protein

EKLSNLETLDIKQTKIE

Gene3D: G3DSA:3.80.10.10
745-938 no description

TNDLAGQLDNLRKLKSVWVCKVTAIHCADLFSAVSKLPLLACLLLNASDEEQTLHLETLNPQSKQFHRLIVRGRWAAGTLQCPIFQGHGKNLKYLALSWSGLHEDPLLLIAPHVPNLTYLSLNRVSSTETMVISEGSFPQLKTLILKNMLNVNQLTVGKDALPNIEGLYLVALPKLNKVPQGFESLVSLRKLWL

Seg: seg
781-789 seg

LPLLACLLL

Seg: seg
929-941 seg

SLVSLRKLWLLSL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox