PRGDB00076589 (Sbi.13475)

From PRG Wiki
Jump to: navigation, search
Sbi.13475
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 242070686 (XM_002450575)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Sorghum bicolor

Comment?

Sorghum bicolor hypothetical protein, mRNA

DNA Sequence

ATGGCAGACCTTGTGGTTGGCCTGGCCAAGACAGTGGTGGAGGGGGCCTTGACCAAGGCTCAGTCAGCGATTGAGGAGGAGGCAAAATTGCAGCAAAGTGTGCAGCACAACCTTGTATTCATTGCTGGTGAGTTTGAGATGATGCACTCCTTCCTCAACGTTGCCAATGAGGAGCGTGTCAAGAACAACGTTGTGAGGACCTGGGTGAGGCAGGTTCGTGATCTGGCATATGATGTGGAGGACTGCATAGAGTTTGTCATCCACCTGGACAACAAGCCAAGGTGGTGGCGCCGTATGCTTCCTCTTTGCCTGGCAGCATCAGCATTGCCCTTAGATGAGGCGGTAACTGAGATAGAGCGGCTCAAGGTTAGGGTTGAGGATGTGAGTCGAAGGAACTCACGCTACAGCCTCATCAGCGACTCTGGATCCAAGCCCATCATGCAGCAACAGATGGCACCCAACACTGCTTTTGGCACAATGGCGCTTGACATGCTGGTTGAGGCGAGGGACACCGCAAAAAAGCAGCAAGGTTTTGGAGACCTCACCCAGCTACTCACAAAGGAACAAGCTGACCTTGGGGTAATCTCAGTGTGGGGAACAGGCAGTGAACTTGGTACAACATCCATCATCAGAAAGACGTACCAGGACCCAGAACTCTGTCGAAAAATTGGATGTCGTGGCTGGGTGAAGCTTACACAACCTTTCAATCCCCACGAGTTCCTCCGCAGTATGGTGGCTCAGTTCTACAGAAACAGTTGTCTGCAAAAAGGAATCGTTATAAATGTGGAGGAACTGAAGAGGATTGAGGTAATGGCGACAACGGAAGGCAGACTCATTGAGGCATTTATGGATAAAGTAAATGAGAACAGATACCTAGTCGTCCTGGAAAATCTGTCCACAATTGGAGATTGGGACACCATCAGGACTTACCTGCCAGACAGGAAGAATGGAAGTTGGATCATTGTATCCACACAGCAGTGCGAAATTGCAAGCTTGTGCATTGGGCATTCATACCAAGTATCGGAGGTGAAGCAGTACTCAGCAGAGCACTCTGTATGTGTCTTCTTCGAGGAGGGTTTGCAAGGTGATGGTGATAAAAGCATGGAATCTGATAGAGTGGTAGACAACAGCAATGAAATATCAATGCAGGATGAAGCAACCCATGTTAATGGCTTTCTGTCCTACAGAATTCCAACATCTAAACGGAAGGCTGCCTCTGATTGGGTGAAGAATTTTCAACTTGTTGAACGCAAGTCAGAAATGAACCAACTTGTTAACTATATTGCTAAGGCATATCTCAATGGTTTGCAAGTGCTGTCTGTGTGGGGGATAGCTGGTGTTGGGAAATCAGCCCTTGTTAGGAACATGTACTTTGACAGAATTCATCGAAATGACCAATTATTTGAGAAGTATGGTTGGGTGGATGTAACCCACCCATTCAATTTAAGGGACTTCTCCCGCAGTTTGCTTTTGGATTTTTATTCAGAACCTGTTCAAGCCATGAGAATCAGAGACCCTACACAAGAGTGTCATAAGATTATACAGGATAATCGGTGCCTTGTTGTTATTGATGATCTGCAGTCCATCGAAGAATGGGACTTAATACAAGCTGCCTTGGTGTCTAGACCTTCTAGAAGTATTATCATTGTAATTACAACTGAAGCTAGCATTGCCACACATTGTGCAGACAATGAAGGGGTCGTATTTAATGTCAAAGGTCTAGAAGACAAAGCAGCCCTCAAGCTCTTCAAAAAGCAGGTACATAAGCAAAAACCATCATCTCCTATAAAGGACTCCCGAGATGAAGAGCTACAAGAACTTATTTTGAAGTGCGGTGGTCTTCCCAAGGTGATAGTTGCCGTAGCTATTTTTTTGGCACCTAAAACAGTCACATGGATGGATAGTGCAAGTTCTTTGAACCTCAAATTTATGCAAGAGCTGGAGAGCAGCCCAGAGTTTGCTTGCCTGCAGCCACTCTTTGGTTGGCTGCACTCCTACTTTCGAACTTGCCCAGATTTCCTCAAGCCATGTATCTTCTATCTGTCAATTTTTCCTCGAGGTCACAGGATCCGGAGAAGGCGATTGGTGAGACGGTGGATTGCAGAGGGCTATGCCAGGGACACGGACAAAATTTCTGCGGATGAGAGAGGGGAGCACTTCTTCTGCAGGCTCCTCGATCTGAGCATAATAATGCAGAAAACATATTCAGTCACCACCACATTCGGTGGCAGAAGAATGACTTTGTGCCAAGTCAATAGTTTTGTCCGGGAGTATATCATCTCACGTCAAATGGAAGAGAACCTTGTATTTGAACTGGGAGGCAGTTGCACCCTAACCTCTCAGCGCACGGGGCGTCACCTCATCATACTGAAAAGCTGGGACAGAGACAGAATTGTGTTTGAGAGCATTGACTTCTCACGGCTACGGTCTTTGACAGTGTTTGGAGAATGGAGGCCATTCTTCATATCTGATAGGATGAGGTTACTTCGGGTTCTGGATCTTGAGGATGCATCTGGTTTAAAAGATGAAGATGTTAAACAAATGATGAAGCTGCTTTGTCGCCTCAAGTATCTTTCCTTACGAGGATGCAGTGAGATCTCTAGGCTGCCGAATTCATTGGGTTGTTTGAGGCAGCTTGAGACTCTGGATGTCAGACATACATCCATAGCAACCATGCCAACAACCATCACCAAGCTGAAGAAACTGCAGTACCTTCGTGCTAGTACCACCAAACCAACTGAGGAACAACCAATACCTGATACTGCTGGTGCACCCAAACCTACCGAGAAACAACCAACCCCACGCACCACAGTATCATGGACATCATCTTTGTTCTGCAGACATCGACAGCTAGAGGGTGTTGAGGTGCCTACTGGGATAGACAAAATGACTGCATTGCACACCATCGGTGTTGTTAATGTCGATTCTGCTCGAGGGAGGGCCATCTTGAAAGAGGTCAGGAAGCTCACTCAATTGCGCAAGCTTGGAGTGTCTGGAATCAGTAGGAACAACAGCAAAGATTTCTGTTTGGCCATCTCAAGTCATGCGCATTTAGAGTCCTTATCGGTTAGGCTCAAGAAGGACAATCAGGATTGCTTGTATGTCACCCCAGACGGCTATCTTCCCCCCAAGAACCTACAGAGCTTTAAACTGTATGGTCTTGCAGACAAGTTTCCAGAGTGGATCAATAAGCTTGACAATCTCAGGAAGTTAGTTTTGGAGATGACTATATTAACTGAAGATACTATTAATGGACTCAGGGATCTTAAAATATCTATTCTACGTCTCATTGCCAAGCAGCTTCCTGATGGTAAGCTCAATTTTTGTGTCATGTTGAATGGACAGCAATTACGCTGCTATGAAACAGTGAAGGTACTCGAGATTTCTTGCAGCTCCAGCTTAGATGTGACTTTTGGATCACAAGCACTACACAATCTTGAGCTGTTGAAAGTTTCCTGCTGTAGTGGTTCAGGGTCGGTAATGAAGTTGTCTGGGCTAGAAAAACTGTCTGAATCTGAACTCAAGGAAGTCCAGATTAAGGGTTCCCATGATGACAAACTCAAAAAAGACGTGGAGGAACAACTTGGCAGGCATCAAAAGAAACCTGTTTTGAAGATGGAATAAGTACTTTCGTCCACTGGGGATTGTGAGCTCTAATGTTATCAAGAATTAGTGACTCATGTTGTTGGCTTCCTCTTATTTCTTCACTGCTGCTCGATCCAGTCTATCTAATTAGAAAGATTGGTTATGCAACCATCGTGCCAATAATAAACGGTCAAATCTGAAAGCTTCCTCTTTGGCCACATACTGATCAGTCTATTTGTCTTGTGCATGTGGTTCCTACAGCATAGTCCCAGTTTGGATTCCTTCTAAAAGATACTGATGGTGTGCTAATGTTTTTATATGTATAGAGAAGGCTGGAACAGTGAATTGCTGTTGTACTTTTCTATTGCTGGAACAGTGAATTGCTGTTGTACTTTTCTATTGCGCTCCTGTATTGTAGTTTCGTGGTGTATCTTGCTATGGTTATACACACACACATCAGCACAAATTCTTTACCACTACAGCACTACTTCAGCGGTAAATGCTTATGCTGATTTCTTGTAAGAAGAAAACACTGTTTGTAAACTGAAAAATATTGCTAGAGTAGTGCAGACGAACAAAGTTGAC


Protein sequences

Name Description Sequence
Sbi.13475 translated coding region predicted by ESTScan from UniGene Sbi.13475

MADLVVGLAKTVVEGALTKAQSAIEEEAKLQQSVQHNLVFIAGEFEMMHSFLNVANEERVKNNVVRTWVRQVRDLAYDVEDCIEFVIHLDNKPRWWRRMLPLCLAASALPLDEAVTEIERLKVRVEDVSRRNSRYSLISDSGSKPIMQQQMAPNTAFGTMALDMLVEARDTAKKQQGFGDLTQLLTKEQADLGVISVWGTGSELGTTSIIRKTYQDPELCRKIGCRGWVKLTQPFNPHEFLRSMVAQFYRNSCLQKGIVINVEELKRIEVMATTEGRLIEAFMDKVNENRYLVVLENLSTIGDWDTIRTYLPDRKNGSWIIVSTQQCEIASLCIGHSYQVSEVKQYSAEHSVCVFFEEGLQGDGDKSMESDRVVDNSNEISMQDEATHVNGFLSYRIPTSKRKAASDWVKNFQLVERKSEMNQLVNYIAKAYLNGLQVLSVWGIAGVGKSALVRNMYFDRIHRNDQLFEKYGWVDVTHPFNLRDFSRSLLLDFYSEPVQAMRIRDPTQECHKIIQDNRCLVVIDDLQSIEEWDLIQAALVSRPSRSIIIVITTEASIATHCADNEGVVFNVKGLEDKAALKLFKKQVHKQKPSSPIKDSRDEELQELILKCGGLPKVIVAVAIFLAPKTVTWMDSASSLNLKFMQELESSPEFACLQPLFGWLHSYFRTCPDFLKPCIFYLSIFPRGHRIRRRRLVRRWIAEGYARDTDKISADERGEHFFCRLLDLSIIMQKTYSVTTTFGGRRMTLCQVNSFVREYIISRQMEENLVFELGGSCTLTSQRTGRHLIILKSWDRDRIVFESIDFSRLRSLTVFGEWRPFFISDRMRLLRVLDLEDASGLKDEDVKQMMKLLCRLKYLSLRGCSEISRLPNSLGCLRQLETLDVRHTSIATMPTTITKLKKLQYLRASTTKPTEEQPIPDTAGAPKPTEKQPTPRTTVSWTSSLFCRHRQLEGVEVPTGIDKMTALHTIGVVNVDSARGRAILKEVRKLTQLRKLGVSGISRNNSKDFCLAISSHAHLESLSVRLKKDNQDCLYVTPDGYLPPKNLQSFKLYGLADKFPEWINKLDNLRKLVLEMTILTEDTINGLRDLKISILRLIAKQLPDGKLNFCVMLNGQQLRCYETVKVLEISCSSSLDVTFGSQALHNLELLKVSCCSGSGSVMKLSGLEKLSESELKEVQIKGSHDDKLKKDVEEQLGRHQKKPVLKME

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF212
6-1179 PTHR23155:SF212,OS11G0609700 PROTEIN

VGLAKTVVEGALTKAQSAIEEEAKLQQSVQHNLVFIAGEFEMMHSFLNVANEERVKNNVVRTWVRQVRDLAYDVEDCIEFVIHLDNKPRWWRRMLPLCLAASALPLDEAVTEIERLKVRVEDVSRRNSRYSLISDSGSKPIMQQQMAPNTAFGTMALDMLVEARDTAKKQQGFGDLTQLLTKEQADLGVISVWGTGSELGTTSIIRKTYQDPELCRKIGCRGWVKLTQPFNPHEFLRSMVAQFYRNSCLQKGIVINVEELKRIEVMATTEGRLIEAFMDKVNENRYLVVLENLSTIGDWDTIRTYLPDRKNGSWIIVSTQQCEIASLCIGHSYQVSEVKQYSAEHSVCVFFEEGLQGDGDKSMESDRVVDNSNEISMQDEATHVNGFLSYRIPTSKRKAASDWVKNFQLVERKSEMNQLVNYIAKAYLNGLQVLSVWGIAGVGKSALVRNMYFDRIHRNDQLFEKYGWVDVTHPFNLRDFSRSLLLDFYSEPVQAMRIRDPTQECHKIIQDNRCLVVIDDLQSIEEWDLIQAALVSRPSRSIIIVITTEASIATHCADNEGVVFNVKGLEDKAALKLFKKQVHKQKPSSPIKDSRDEELQELILKCGGLPKVIVAVAIFLAPKTVTWMDSASSLNLKFMQELESSPEFACLQPLFGWLHSYFRTCPDFLKPCIFYLSIFPRGHRIRRRRLVRRWIAEGYARDTDKISADERGEHFFCRLLDLSIIMQKTYSVTTTFGGRRMTLCQVNSFVREYIISRQMEENLVFELGGSCTLTSQRTGRHLIILKSWDRDRIVFESIDFSRLRSLTVFGEWRPFFISDRMRLLRVLDLEDASGLKDEDVKQMMKLLCRLKYLSLRGCSEISRLPNSLGCLRQLETLDVRHTSIATMPTTITKLKKLQYLRASTTKPTEEQPIPDTAGAPKPTEKQPTPRTTVSWTSSLFCRHRQLEGVEVPTGIDKMTALHTIGVVNVDSARGRAILKEVRKLTQLRKLGVSGISRNNSKDFCLAISSHAHLESLSVRLKKDNQDCLYVTPDGYLPPKNLQSFKLYGLADKFPEWINKLDNLRKLVLEMTILTEDTINGLRDLKISILRLIAKQLPDGKLNFCVMLNGQQLRCYETVKVLEISCSSSLDVTFGSQALHNLELLKVSCCSGSGSVMKLSGLEKLSESELKEVQI

HMMPanther: PTHR23155
6-1179 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VGLAKTVVEGALTKAQSAIEEEAKLQQSVQHNLVFIAGEFEMMHSFLNVANEERVKNNVVRTWVRQVRDLAYDVEDCIEFVIHLDNKPRWWRRMLPLCLAASALPLDEAVTEIERLKVRVEDVSRRNSRYSLISDSGSKPIMQQQMAPNTAFGTMALDMLVEARDTAKKQQGFGDLTQLLTKEQADLGVISVWGTGSELGTTSIIRKTYQDPELCRKIGCRGWVKLTQPFNPHEFLRSMVAQFYRNSCLQKGIVINVEELKRIEVMATTEGRLIEAFMDKVNENRYLVVLENLSTIGDWDTIRTYLPDRKNGSWIIVSTQQCEIASLCIGHSYQVSEVKQYSAEHSVCVFFEEGLQGDGDKSMESDRVVDNSNEISMQDEATHVNGFLSYRIPTSKRKAASDWVKNFQLVERKSEMNQLVNYIAKAYLNGLQVLSVWGIAGVGKSALVRNMYFDRIHRNDQLFEKYGWVDVTHPFNLRDFSRSLLLDFYSEPVQAMRIRDPTQECHKIIQDNRCLVVIDDLQSIEEWDLIQAALVSRPSRSIIIVITTEASIATHCADNEGVVFNVKGLEDKAALKLFKKQVHKQKPSSPIKDSRDEELQELILKCGGLPKVIVAVAIFLAPKTVTWMDSASSLNLKFMQELESSPEFACLQPLFGWLHSYFRTCPDFLKPCIFYLSIFPRGHRIRRRRLVRRWIAEGYARDTDKISADERGEHFFCRLLDLSIIMQKTYSVTTTFGGRRMTLCQVNSFVREYIISRQMEENLVFELGGSCTLTSQRTGRHLIILKSWDRDRIVFESIDFSRLRSLTVFGEWRPFFISDRMRLLRVLDLEDASGLKDEDVKQMMKLLCRLKYLSLRGCSEISRLPNSLGCLRQLETLDVRHTSIATMPTTITKLKKLQYLRASTTKPTEEQPIPDTAGAPKPTEKQPTPRTTVSWTSSLFCRHRQLEGVEVPTGIDKMTALHTIGVVNVDSARGRAILKEVRKLTQLRKLGVSGISRNNSKDFCLAISSHAHLESLSVRLKKDNQDCLYVTPDGYLPPKNLQSFKLYGLADKFPEWINKLDNLRKLVLEMTILTEDTINGLRDLKISILRLIAKQLPDGKLNFCVMLNGQQLRCYETVKVLEISCSSSLDVTFGSQALHNLELLKVSCCSGSGSVMKLSGLEKLSESELKEVQI

HMMPfam: PF00931
IPR002182
179-358 NB-ARC,NBS
NB-ARC

GDLTQLLTKEQADLGVISVWGTGSELGTTSIIRKTYQDPELCRKIGCRGWVKLTQPFNPHEFLRSMVAQFYRNSCLQKGIVINVEELKRIEVMATTEGRLIEAFMDKVNENRYLVVLENLSTIGDWDTIRTYLPDRKNGSWIIVSTQQCEIASLCIGHSYQVSEVKQYSAEHSVCVFFEE

superfamily: SSF52540
397-649 SSF52540

IPTSKRKAASDWVKNFQLVERKSEMNQLVNYIAKAYLNGLQVLSVWGIAGVGKSALVRNMYFDRIHRNDQLFEKYGWVDVTHPFNLRDFSRSLLLDFYSEPVQAMRIRDPTQECHKIIQDNRCLVVIDDLQSIEEWDLIQAALVSRPSRSIIIVITTEASIATHCADNEGVVFNVKGLEDKAALKLFKKQVHKQKPSSPIKDSRDEELQELILKCGGLPKVIVAVAIFLAPKTVTWMDSASSLNLKFMQELES

Gene3D: G3DSA:3.40.50.300
414-553 G3DSA:3.40.50.300

LVERKSEMNQLVNYIAKAYLNGLQVLSVWGIAGVGKSALVRNMYFDRIHRNDQLFEKYGWVDVTHPFNLRDFSRSLLLDFYSEPVQAMRIRDPTQECHKIIQDNRCLVVIDDLQSIEEWDLIQAALVSRPSRSIIIVITT

HMMPfam: PF00931
IPR002182
418-705 NB-ARC,NBS
NB-ARC

KSEMNQLVNYIAKAYLNGLQVLSVWGIAGVGKSALVRNMYFDRIHRNDQLFEKYGWVDVTHPFNLRDFSRSLLLDFYSEPVQAMRIRDPTQECHKIIQDNRCLVVIDDLQSIEEWDLIQAALVSRPSRSIIIVITTEASIATHCADNEGVVFNVKGLEDKAALKLFKKQVHKQKPSSPIKDSRDEELQELILKCGGLPKVIVAVAIFLAPKTVTWMDSASSLNLKFMQELESSPEFACLQPLFGWLHSYFRTCPDFLKPCIFYLSIFPRGHRIRRRRLVRRWIAEGYA

FPrintScan: PR00364
IPR000767
438-453 DISEASERSIST
Disease resistance protein

VLSVWGIAGVGKSALV

FPrintScan: PR00364
IPR000767
513-527 DISEASERSIST
Disease resistance protein

IIQDNRCLVVIDDLQ

FPrintScan: PR00364
IPR000767
611-625 DISEASERSIST
Disease resistance protein

CGGLPKVIVAVAIFL

Gene3D: G3DSA:3.80.10.10
794-914 G3DSA:3.80.10.10

DRDRIVFESIDFSRLRSLTVFGEWRPFFISDRMRLLRVLDLEDASGLKDEDVKQMMKLLCRLKYLSLRGCSEISRLPNSLGCLRQLETLDVRHTSIATMPTTITKLKKLQYLRASTTKPTE

superfamily: SSF52047
805-1088 SSF52047,LRR

FSRLRSLTVFGEWRPFFISDRMRLLRVLDLEDASGLKDEDVKQMMKLLCRLKYLSLRGCSEISRLPNSLGCLRQLETLDVRHTSIATMPTTITKLKKLQYLRASTTKPTEEQPIPDTAGAPKPTEKQPTPRTTVSWTSSLFCRHRQLEGVEVPTGIDKMTALHTIGVVNVDSARGRAILKEVRKLTQLRKLGVSGISRNNSKDFCLAISSHAHLESLSVRLKKDNQDCLYVTPDGYLPPKNLQSFKLYGLADKFPEWINKLDNLRKLVLEMTILTEDTINGLRD

FPrintScan: PR00364
IPR000767
824-840 DISEASERSIST
Disease resistance protein

DRMRLLRVLDLEDASGL

Gene3D: G3DSA:3.80.10.10
943-1189 G3DSA:3.80.10.10

SLFCRHRQLEGVEVPTGIDKMTALHTIGVVNVDSARGRAILKEVRKLTQLRKLGVSGISRNNSKDFCLAISSHAHLESLSVRLKKDNQDCLYVTPDGYLPPKNLQSFKLYGLADKFPEWINKLDNLRKLVLEMTILTEDTINGLRDLKISILRLIAKQLPDGKLNFCVMLNGQQLRCYETVKVLEISCSSSLDVTFGSQALHNLELLKVSCCSGSGSVMKLSGLEKLSESELKEVQIKGSHDDKLKK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox