PRGDB00076590 (Sbi.13495)

From PRG Wiki
Jump to: navigation, search
Sbi.13495
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 242071044 (XM_002450754)
Gene Class Unknown
Domain Type LRR
Gene Species Sorghum bicolor

Comment?

Sorghum bicolor hypothetical protein, mRNA

DNA Sequence

ATCTGTGTGGCAAACAGTTCTGAAGTTTGCAGCAATGGCGCCCCAGTTTGCAGCAGCAGGATTCCTCACCGGCCTTCTTGCTCTTGCAACATTTGCAAGCTGCAACACTGAAGGTGACATACTGTACAAGCAAAGGTTGGCATGGGAGGACCCAAACAACGTGCTGCAGAGCTGGAATTCGACGCTTGCCAATCCCTGCACCTGGTTCCATGTCACCTGCAACAACAATAACTCTGTCATCCGCGTGGATTTGGGCAATGCAGGCATCTCCGGTCCTCTGCTTCCAGATCTTGCAGAAATTCAGAACCTCCAGTACATCGAGCTGTATGGCAACGGCCTGAACGGTTCGATTCCAGAAACACTAGGCAACCTGACTAATCTCATCAGCTTGGATCTCTGGGACAACCTTCTTACCGGCGAAATCCCAACTACGCTTGGTTATGTCAGCACGCTGCGATATCTGAGGTTGTACCAAAACAACCTGACAGGGCCTATACCATCATCGTTTGGCAACCTGACTAGCCTTCTGGAATTGAAGCTTCAAGAGAATTCGTTGAGCGGCGCTATTCCGGCCTCCCTTGGCAACATCAAAGCATTACAATTCTTGAGATTAAACGATAATATGCTGACTGGCACGGTTCCATCGGAAGTCCTCTCCCTTGTCATTTCTGGCAACCTGACTGAGCTAAATATTGCTAGAAACAACCTGGATGGCACTGAGACATCGTCTGGACTGAGAGTGACTGCGATTATCCAGGATGCGCTGAAGACTGCATGATGGCTTGATGAGTCCTAGGATCAAGGCTTTGTTTTAATTTGCTTTATGCAATCGCTGGAAATAAATGAATAATTCCAATGGGGTGCATTGGTCTAGACATCTTGCAGTAGAATATGTTTGTCGAGTTTAGCTCAATTTGTATGGAAATAATGGATAATGTGAGTTAGACATCTATTTCTCTATaaaaaaactaaaaTGGTTTTTGTCCTG


Protein sequences

Name Description Sequence
Sbi.13495 translated coding region predicted by ESTScan from UniGene Sbi.13495

MAPQFAAAGFLTGLLALATFASCNTEGDILYKQRLAWEDPNNVLQSWNSTLANPCTWFHVTCNNNNSVIRVDLGNAGISGPLLPDLAEIQNLQYIELYGNGLNGSIPETLGNLTNLISLDLWDNLLTGEIPTTLGYVSTLRYLRLYQNNLTGPIPSSFGNLTSLLELKLQENSLSGAIPASLGNIKALQFLRLNDNMLTGTVPSEVLSLVISGNLTELNIARNNLDGTETSSGLRVTAIIQDALKTA


Domains

Domain Start-End Description Sequence

superfamily: SSF52058
20-228 SSF52058,LRR

FASCNTEGDILYKQRLAWEDPNNVLQSWNSTLANPCTWFHVTCNNNNSVIRVDLGNAGISGPLLPDLAEIQNLQYIELYGNGLNGSIPETLGNLTNLISLDLWDNLLTGEIPTTLGYVSTLRYLRLYQNNLTGPIPSSFGNLTSLLELKLQENSLSGAIPASLGNIKALQFLRLNDNMLTGTVPSEVLSLVISGNLTELNIARNNLDGT

HMMPanther: PTHR24420:SF610
24-240 PTHR24420:SF610

NTEGDILYKQRLAWEDPNNVLQSWNSTLANPCTWFHVTCNNNNSVIRVDLGNAGISGPLLPDLAEIQNLQYIELYGNGLNGSIPETLGNLTNLISLDLWDNLLTGEIPTTLGYVSTLRYLRLYQNNLTGPIPSSFGNLTSLLELKLQENSLSGAIPASLGNIKALQFLRLNDNMLTGTVPSEVLSLVISGNLTELNIARNNLDGTETSSGLRVTAII

HMMPanther: PTHR24420
24-240 PTHR24420,FAMILY NOT NAMED

NTEGDILYKQRLAWEDPNNVLQSWNSTLANPCTWFHVTCNNNNSVIRVDLGNAGISGPLLPDLAEIQNLQYIELYGNGLNGSIPETLGNLTNLISLDLWDNLLTGEIPTTLGYVSTLRYLRLYQNNLTGPIPSSFGNLTSLLELKLQENSLSGAIPASLGNIKALQFLRLNDNMLTGTVPSEVLSLVISGNLTELNIARNNLDGTETSSGLRVTAII

HMMPfam: PF08263
IPR013210
24-63 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

NTEGDILYKQRLAWEDPNNVLQSWNSTLANPCTWFHVTCN

Gene3D: G3DSA:3.80.10.10
26-229 G3DSA:3.80.10.10

EGDILYKQRLAWEDPNNVLQSWNSTLANPCTWFHVTCNNNNSVIRVDLGNAGISGPLLPDLAEIQNLQYIELYGNGLNGSIPETLGNLTNLISLDLWDNLLTGEIPTTLGYVSTLRYLRLYQNNLTGPIPSSFGNLTSLLELKLQENSLSGAIPASLGNIKALQFLRLNDNMLTGTVPSEVLSLVISGNLTELNIARNNLDGTE

HMMPfam: PF00560
IPR001611
91-113 LRR_1
Leucine-rich repeat

NLQYIELYGNGLNGSIPETLGNL

HMMPfam: PF13855
139-198 LRR_8,Leucine rich repeat

TLRYLRLYQNNLTGPIPSSFGNLTSLLELKLQENSLSGAIPASLGNIKALQFLRLNDNML

HMMPfam: PF13516
214-227 LRR_6,Leucine Rich repeat

NLTELNIARNNLDG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox