PRGDB00076596 (Sbi.14113)

From PRG Wiki
Jump to: navigation, search
Sbi.14113
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 242077888 (XM_002443668)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Sorghum bicolor

Comment?

Sorghum bicolor hypothetical protein, mRNA

DNA Sequence

ATGGGGGCTCTGAAGCCTGTCTTGGAAAAGCTTGCCACGCTCCTGGGCGACAAGTACAAGAAGCTCAAGGGTATTCGGAAGGAGGTGTCCTTCCTCATGGAAGAGCTAAGCGACATGAAAGTCCTCCTTGAGAACATGGACAATGCTGAGGATGAGCTCAATCCGCAGGCCAAGAAATGGAGGAAAGATATAATTGACATGTCATATGATATTGAAGATTGCATTGACAACTTCATGGACCGTGTTGGGGACGCCGATGACAAGGTGGGGATCCTCAAGAAAGCTTCTCACTATCTGAGAACTATCAACGATCGGTACCGCATAGCCAATCAGATCAATGAGATCAAGACTCGTGTGATTGAAGCAAGCAAACGCCGAGATAGGTACAATCTCAATGTGTGCACCTCTGGTTCTACCACAATAGTGGCTGTTGATCCTCGCCTGACTGCACTTTACACGGATTCAACAACCCTTGTGGGCATTGGCACTCAAAAGGAAGAACTTGTCAAATGGGTAGAGGATGAAGAGAAACAACTAAAGGTGATGTCAATAGTAGGATTTGGAGGTTTAGGCAAGACCACGCTTGCCAATGAGGTATATCATGACGTTGAAGGGCATTTCAATAGCAAGGCATTTGTGCCAGTTTCTCAGAAGCCAGACATATCAAGGCTACTCAATAGCGTGTGTTCAAAACTTGGGCTGTCTTCATATTCTCATGCTTGCGAAGTGCAAGACCTAATTGACAATTTGAGAGAATACCTACATGATAAGAGGTACCTCATTGTACTTGATGATTTGTGGGAAGTGAAACATTGGGATATCATTAGTTGTGCTTTTCCAAAGAATAGTCAACAAAGCAGGCTTATTGTGACTACAAGAATTGAAGGTGTGGCTCAGGCATGTTGCAAGGACCATGGGCGCATTCATTATATGAAACCACTAAGTGACGCGGACTCAAGAAAGTTATTCTTTAGAAGGATTTTTGGCACTGAAGATACTTGCCCTCCTCAGTTCACAGAAGTTTCATCTGAAATTCTAAAGAAGTGCGGTGGTTTGCCACTTGCAATTGTCACTATGGCTAGCTCTTTAGCAGACCAACCCAAAGAGCACTGGGACTACATACAACGTTCTATAGTCACTGAATCTGCAGCAAACTCCTTGGCTGACATGATGCAGATCTTAGACCTGAGCTATAAGCACCTTCCTCATCATCTAAGAGCATGCTTTTTGTATCTCGGTATTTATCCTGAGGACTACGAGATTGAAAGGGATCAGCTGATTTACTTGTGGGTGGCAGAACGTATTGTGACGAGCAAGTCTCCAATGCAAGATGTAAAGGATGTAGCAGAGAGCTGTTTCAATGAACTTGTCAATAGGAACATGATTCAACCAGAATCCTATTACTACAGAGTACATGATATGATGCTGGATCTAATCATAAAGAGGTGCAGAGAAGATAATTTTGTAAGTGTTGTGCACAGTGCACAGGTGGTGGTAGAACGGCAAGACAGGGTTCATCGTTTGTCAGTCAGCTTGAGTGATGTTCCAGATGATGACTCCATATTTCAGGTGGCCACTAATTGCTGCCGATCACAAGTTCGTTCTCTTGTCATCCTTGAAGCATCAAAATGGATGCCTCCACTGTTGGAGCTAAAGTCTCTTCGGGTGCTTTTCCTTAAATTTCCGAAGCACCTGAAGACAATGGACCTCACAGGTGTTTGCCAATTGTCTCAACTGAGATACTTAAAGGTTGATGATAGGATATACTATTCAGAGCGTTCAATTGTGCTACCAAGTGAAATTGGGAGGATGCGACATTTGGAGAGGCTGGAAATACCTAATATATGCATTTGTAGCATTCCATCAGACATTGTTGACTTGCCACGCTTGTCACATCTCATCTTGTCAGATGATACAAGTTTGCCGGACGGGATTGGGAAAATGAAATCTCTGCGTACGTTGAGGTCATTTTTATTAGCAGAGAGCTCACCAGAGGATATTAAGGGCCTCGGCCAACTCAACAAGCTAGAAGACTTGGAGGTGCGGTGCCACGGAGAAAGATACAACCACAAGCATAGGCCGAAACGAATGGATGCTCTGATTTTTTCCCTGGAGAAACTAAGTAACCTCAAAAGCTTTTTCCTGTCATCTGAATTTACTGCTGTCAAAGCCGATGCCCTGCTCTTGCTTTCACCTCCTTTCCAAAATCTCGAGGTGCTCTATCTGCACGGACTGATCTTCTCTAGAGTTCCTAGGTGGATCGGAGGTCTCCAAAAGCTTTGTCGGTTGACACTCGGAGCAAAGCAGATGACCCAGGAAGATATTAACATCATTGGAACACTGCCCTATCTCACCGGCCTCCGGCTGCGGATCTCAGGCATGCCAACAGGCACGATCGTGATAGGTGGGACCACAGGGTTCAACGCTCTCGAGTTTTTTGTGTACGACTGTGATGTTATGTCATATCTGGCATTTGAGGACGGAGCTATGCCCAGCCTCCAGAAGCTTGGTTTACTACTGGATCCACATAAATGGGACAAGGTTACACCTCTTGGTCTCCAATGTCTTTCGAACCTCAAGAAAATAACTGTATGGACGGTTGCCACCAGTTATAGCAACGACGCAGGAGCGGGTGACAAAGAATCAGAGGAGATGTCTGCGGCTGCTTTGGTCCGCAAGGTGTTTCAGGAAGCAGCCAACGCACATCCGAGTCACCTAGCATATACC


Protein sequences

Name Description Sequence
Sbi.14113 translated coding region predicted by ESTScan from UniGene Sbi.14113

MGALKPVLEKLATLLGDKYKKLKGIRKEVSFLMEELSDMKVLLENMDNAEDELNPQAKKWRKDIIDMSYDIEDCIDNFMDRVGDADDKVGILKKASHYLRTINDRYRIANQINEIKTRVIEASKRRDRYNLNVCTSGSTTIVAVDPRLTALYTDSTTLVGIGTQKEELVKWVEDEEKQLKVMSIVGFGGLGKTTLANEVYHDVEGHFNSKAFVPVSQKPDISRLLNSVCSKLGLSSYSHACEVQDLIDNLREYLHDKRYLIVLDDLWEVKHWDIISCAFPKNSQQSRLIVTTRIEGVAQACCKDHGRIHYMKPLSDADSRKLFFRRIFGTEDTCPPQFTEVSSEILKKCGGLPLAIVTMASSLADQPKEHWDYIQRSIVTESAANSLADMMQILDLSYKHLPHHLRACFLYLGIYPEDYEIERDQLIYLWVAERIVTSKSPMQDVKDVAESCFNELVNRNMIQPESYYYRVHDMMLDLIIKRCREDNFVSVVHSAQVVVERQDRVHRLSVSLSDVPDDDSIFQVATNCCRSQVRSLVILEASKWMPPLLELKSLRVLFLKFPKHLKTMDLTGVCQLSQLRYLKVDDRIYYSERSIVLPSEIGRMRHLERLEIPNICICSIPSDIVDLPRLSHLILSDDTSLPDGIGKMKSLRTLRSFLLAESSPEDIKGLGQLNKLEDLEVRCHGERYNHKHRPKRMDALIFSLEKLSNLKSFFLSSEFTAVKADALLLLSPPFQNLEVLYLHGLIFSRVPRWIGGLQKLCRLTLGAKQMTQEDINIIGTLPYLTGLRLRISGMPTGTIVIGGTTGFNALEFFVYDCDVMSYLAFEDGAMPSLQKLGLLLDPHKWDKVTPLGLQCLSNLKKITVWTVATSYSNDAGAGDKESEEMSAAALVRKVFQEAANAHPSHLAYT

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
1-909 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MGALKPVLEKLATLLGDKYKKLKGIRKEVSFLMEELSDMKVLLENMDNAEDELNPQAKKWRKDIIDMSYDIEDCIDNFMDRVGDADDKVGILKKASHYLRTINDRYRIANQINEIKTRVIEASKRRDRYNLNVCTSGSTTIVAVDPRLTALYTDSTTLVGIGTQKEELVKWVEDEEKQLKVMSIVGFGGLGKTTLANEVYHDVEGHFNSKAFVPVSQKPDISRLLNSVCSKLGLSSYSHACEVQDLIDNLREYLHDKRYLIVLDDLWEVKHWDIISCAFPKNSQQSRLIVTTRIEGVAQACCKDHGRIHYMKPLSDADSRKLFFRRIFGTEDTCPPQFTEVSSEILKKCGGLPLAIVTMASSLADQPKEHWDYIQRSIVTESAANSLADMMQILDLSYKHLPHHLRACFLYLGIYPEDYEIERDQLIYLWVAERIVTSKSPMQDVKDVAESCFNELVNRNMIQPESYYYRVHDMMLDLIIKRCREDNFVSVVHSAQVVVERQDRVHRLSVSLSDVPDDDSIFQVATNCCRSQVRSLVILEASKWMPPLLELKSLRVLFLKFPKHLKTMDLTGVCQLSQLRYLKVDDRIYYSERSIVLPSEIGRMRHLERLEIPNICICSIPSDIVDLPRLSHLILSDDTSLPDGIGKMKSLRTLRSFLLAESSPEDIKGLGQLNKLEDLEVRCHGERYNHKHRPKRMDALIFSLEKLSNLKSFFLSSEFTAVKADALLLLSPPFQNLEVLYLHGLIFSRVPRWIGGLQKLCRLTLGAKQMTQEDINIIGTLPYLTGLRLRISGMPTGTIVIGGTTGFNALEFFVYDCDVMSYLAFEDGAMPSLQKLGLLLDPHKWDKVTPLGLQCLSNLKKITVWTVATSYSNDAGAGDKESEEMSAAALVRKVFQEAANAHPSHLAYT

HMMPanther: PTHR23155:SF163
1-909 PTHR23155:SF163,OS08G0107000 PROTEIN

MGALKPVLEKLATLLGDKYKKLKGIRKEVSFLMEELSDMKVLLENMDNAEDELNPQAKKWRKDIIDMSYDIEDCIDNFMDRVGDADDKVGILKKASHYLRTINDRYRIANQINEIKTRVIEASKRRDRYNLNVCTSGSTTIVAVDPRLTALYTDSTTLVGIGTQKEELVKWVEDEEKQLKVMSIVGFGGLGKTTLANEVYHDVEGHFNSKAFVPVSQKPDISRLLNSVCSKLGLSSYSHACEVQDLIDNLREYLHDKRYLIVLDDLWEVKHWDIISCAFPKNSQQSRLIVTTRIEGVAQACCKDHGRIHYMKPLSDADSRKLFFRRIFGTEDTCPPQFTEVSSEILKKCGGLPLAIVTMASSLADQPKEHWDYIQRSIVTESAANSLADMMQILDLSYKHLPHHLRACFLYLGIYPEDYEIERDQLIYLWVAERIVTSKSPMQDVKDVAESCFNELVNRNMIQPESYYYRVHDMMLDLIIKRCREDNFVSVVHSAQVVVERQDRVHRLSVSLSDVPDDDSIFQVATNCCRSQVRSLVILEASKWMPPLLELKSLRVLFLKFPKHLKTMDLTGVCQLSQLRYLKVDDRIYYSERSIVLPSEIGRMRHLERLEIPNICICSIPSDIVDLPRLSHLILSDDTSLPDGIGKMKSLRTLRSFLLAESSPEDIKGLGQLNKLEDLEVRCHGERYNHKHRPKRMDALIFSLEKLSNLKSFFLSSEFTAVKADALLLLSPPFQNLEVLYLHGLIFSRVPRWIGGLQKLCRLTLGAKQMTQEDINIIGTLPYLTGLRLRISGMPTGTIVIGGTTGFNALEFFVYDCDVMSYLAFEDGAMPSLQKLGLLLDPHKWDKVTPLGLQCLSNLKKITVWTVATSYSNDAGAGDKESEEMSAAALVRKVFQEAANAHPSHLAYT

superfamily: SSF52540
141-385 SSF52540

IVAVDPRLTALYTDSTTLVGIGTQKEELVKWVEDEEKQLKVMSIVGFGGLGKTTLANEVYHDVEGHFNSKAFVPVSQKPDISRLLNSVCSKLGLSSYSHACEVQDLIDNLREYLHDKRYLIVLDDLWEVKHWDIISCAFPKNSQQSRLIVTTRIEGVAQACCKDHGRIHYMKPLSDADSRKLFFRRIFGTEDTCPPQFTEVSSEILKKCGGLPLAIVTMASSLADQPKEHWDYIQRSIVTESAAN

Gene3D: G3DSA:3.40.50.300
163-269 G3DSA:3.40.50.300

TQKEELVKWVEDEEKQLKVMSIVGFGGLGKTTLANEVYHDVEGHFNSKAFVPVSQKPDISRLLNSVCSKLGLSSYSHACEVQDLIDNLREYLHDKRYLIVLDDLWEV

HMMPfam: PF00931
IPR002182
163-439 NB-ARC,NBS
NB-ARC

TQKEELVKWVEDEEKQLKVMSIVGFGGLGKTTLANEVYHDVEGHFNSKAFVPVSQKPDISRLLNSVCSKLGLSSYSHACEVQDLIDNLREYLHDKRYLIVLDDLWEVKHWDIISCAFPKNSQQSRLIVTTRIEGVAQACCKDHGRIHYMKPLSDADSRKLFFRRIFGTEDTCPPQFTEVSSEILKKCGGLPLAIVTMASSLADQPKEHWDYIQRSIVTESAANSLADMMQILDLSYKHLPHHLRACFLYLGIYPEDYEIERDQLIYLWVAERIVTSK

FPrintScan: PR00364
IPR000767
181-196 DISEASERSIST
Disease resistance protein

VMSIVGFGGLGKTTLA

FPrintScan: PR00364
IPR000767
253-267 DISEASERSIST
Disease resistance protein

YLHDKRYLIVLDDLW

FPrintScan: PR00364
IPR000767
349-363 DISEASERSIST
Disease resistance protein

CGGLPLAIVTMASSL

Gene3D: G3DSA:3.80.10.10
503-710 G3DSA:3.80.10.10

DRVHRLSVSLSDVPDDDSIFQVATNCCRSQVRSLVILEASKWMPPLLELKSLRVLFLKFPKHLKTMDLTGVCQLSQLRYLKVDDRIYYSERSIVLPSEIGRMRHLERLEIPNICICSIPSDIVDLPRLSHLILSDDTSLPDGIGKMKSLRTLRSFLLAESSPEDIKGLGQLNKLEDLEVRCHGERYNHKHRPKRMDALIFSLEKLSNL

superfamily: SSF52047
505-790 SSF52047,LRR

VHRLSVSLSDVPDDDSIFQVATNCCRSQVRSLVILEASKWMPPLLELKSLRVLFLKFPKHLKTMDLTGVCQLSQLRYLKVDDRIYYSERSIVLPSEIGRMRHLERLEIPNICICSIPSDIVDLPRLSHLILSDDTSLPDGIGKMKSLRTLRSFLLAESSPEDIKGLGQLNKLEDLEVRCHGERYNHKHRPKRMDALIFSLEKLSNLKSFFLSSEFTAVKADALLLLSPPFQNLEVLYLHGLIFSRVPRWIGGLQKLCRLTLGAKQMTQEDINIIGTLPYLTGLRLR

FPrintScan: PR00364
IPR000767
549-565 DISEASERSIST
Disease resistance protein

LELKSLRVLFLKFPKHL

Gene3D: G3DSA:3.80.10.10
711-797 G3DSA:3.80.10.10

KSFFLSSEFTAVKADALLLLSPPFQNLEVLYLHGLIFSRVPRWIGGLQKLCRLTLGAKQMTQEDINIIGTLPYLTGLRLRISGMPTG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox