PRGDB00076599 (Sbi.14433)

From PRG Wiki
Jump to: navigation, search
Sbi.14433
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 30970738 (CD227304)
Gene Class Unknown
Domain Type NBS
Gene Species Sorghum bicolor

Comment?

CCC1_50_G02.g1_A007 Callus culture

DNA Sequence

ACACCCATTGCAtctccctcctccctccctctcactctctttgtttcgccgcccatccgtctctctcatctcatctcatacatactccaatactccatcaatccatccatcacacaccaccaGTGATCGATCACTCGACCCATAATCGATGGCGGCGgcagcagcagcagcagacgcatcatcagcagAAGCGCCGCCGTCGCCGCCGGCGGCGAGCCGGGTGGTGTGGGTGAACGGGCCGATCGTGGTGGGCGCGGGGCCAGCGGGTCTCTCAGTGGCGGCGTGCCTGCGCGCGCGCGGGGTTCCCTGCGTCGTGCTTGACCGCGCCGACTGCATCGCGTCGCTGTGGCAGCGCCGCACCTACGACCGGCTCCGCCTCCACCTGCCTCGCCACTTCTGCGAGCTCCCTGGCTTGCCGTTCCCCGACAACTACCCGGAGTACCCCACCAAGCGCCAGTTCGTCGACTACCTCAACGCCTACGCGGAGCAAGCGGGCGTCCAGCCGAGGTTCAACCAGGCCGTCACGTCGGCGCGCTACGACGCCGCCGCGGGGTTCTGGAGGGTGCGCGCCGACGACGTCGTCCTCGCCGAGGACGCCGCCGCCGTCGCCGCCGGCGCTACGACGACNGAGTACATCGGCCGCTGGCTCGTCGTCGCCACGGG


Protein sequences

Name Description Sequence
Sbi.14433 translated coding region predicted by ESTScan from UniGene Sbi.14433

MAAAAAAADASSAEAPPSPPAASRVVWVNGPIVVGAGPAGLSVAACLRARGVPCVVLDRADCIASLWQRRTYDRLRLHLPRHFCELPGLPFPDNYPEYPTKRQFVDYLNAYAEQAGVQPRFNQAVTSARYDAAAGFWRVRADDVVLAEDAAAVAAGATTTEYIGRWLVVATG

Domains

Domain Start-End Description Sequence

Seg: seg
2-23 seg

AAAAAAADASSAEAPPSPPAAS

HMMPanther: PTHR23023:SF5
22-172 MONOOXYGENASE,MONOOXYGENASE

ASRVVWVNGPIVVGAGPAGLSVAACLRARGVPCVVLDRADCIASLWQRRTYDRLRLHLPRHFCELPGLPFPDNYPEYPTKRQFVDYLNAYAEQAGVQPRFNQAVTSARYDAAAGFWRVRADDVVLAEDAAAVAAGATTTEYIGRWLVVATG

HMMPanther: PTHR23023
22-172 FAMILY NOT NAMED,DIMETHYLANILINE MONOOXYGENASE

ASRVVWVNGPIVVGAGPAGLSVAACLRARGVPCVVLDRADCIASLWQRRTYDRLRLHLPRHFCELPGLPFPDNYPEYPTKRQFVDYLNAYAEQAGVQPRFNQAVTSARYDAAAGFWRVRADDVVLAEDAAAVAAGATTTEYIGRWLVVATG

FPrintScan: PR00420
IPR003042
30-52 RNGMNOXGNASE
Aromatic-ring hydroxylase-like

GPIVVGAGPAGLSVAACLRARGV

Gene3D: G3DSA:3.50.50.60
32-159 no description

IVVGAGPAGLSVAACLRARGVPCVVLDRADCIASLWQRRTYDRLRLHLPRHFCELPGLPFPDNYPEYPTKRQFVDYLNAYAEQAGVQPRFNQAVTSARYDAAAGFWRVRADDVVLAEDAAAVAAGATT

superfamily: SSF51905
32-157 FAD/NAD(P)-binding domain

IVVGAGPAGLSVAACLRARGVPCVVLDRADCIASLWQRRTYDRLRLHLPRHFCELPGLPFPDNYPEYPTKRQFVDYLNAYAEQAGVQPRFNQAVTSARYDAAAGFWRVRADDVVLAEDAAAVAAGA

HMMPfam: PF13738
32-157 Pyr_redox_3,Pyridine nucleotide-disulphide oxidoreductase

IVVGAGPAGLSVAACLRARGVPCVVLDRADCIASLWQRRTYDRLRLHLPRHFCELPGLPFPDNYPEYPTKRQFVDYLNAYAEQAGVQPRFNQAVTSARYDAAAGFWRVRADDVVLAEDAAAVAAGA

Seg: seg
141-160 seg

ADDVVLAEDAAAVAAGATTT

FPrintScan: PR00420
IPR003042
163-172 RNGMNOXGNASE
Aromatic-ring hydroxylase-like

IGRWLVVATG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox