PRGDB00076604 (Sbi.14863)

From PRG Wiki
Jump to: navigation, search
Sbi.14863
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 242070276 (XM_002450370)
Gene Class N
Domain Type NBS
Gene Species Sorghum bicolor

Comment?

Sorghum bicolor hypothetical protein, mRNA

DNA Sequence

CTCTGCTCTCTGCTGCGGCTACCTACCTAGCTGCTCCTCACACTCCCCCCCTCCATCTCCATCGCCGGCCAACATCAGCTCTTGCGCGCATGCCAGCACCGCTCCCGATTCGTCAGCGCCACCTCGATCATCCCCATCCTGTCTTCTAGCTACCTCCCCTGTGCTTCGTTCGTTCGAGACTCGCCGCCACGCACGCACGCAATGCCTCCTAACGCCCACCAGGACGCGCACGGAAGCAACGCCGGCGGCCTCGCCGTGACGACGACGTCCCCTCCGGCGGCGGCGTCCAACTCCAAGATGGACTGCTTCTGGACCACCGCCTGCACGCCGCTCAACCTCCAGTTCATCGACGTGTCGTACCGCGTCAAGCAGACGACGGACCGATCATCGCCGTCCTCCAGCAAGGCACCACCGCCGGGCGGCCGGATCTCAGCGCACTCGGGTTCCGGCGCCCCCGCGTCGTCGGCGGCAGAGGAGCGGACCATCCTCAAGGGGATCACGGGGGAGGCGCGGCCAGGGGAGGTCCTCGCGGTGCTAGGCCCATCGGGGAGCGGCAAGTCGACGCTGCTGTCGATCCTCGGCGGGCGCCGCCTGGCCGGGCGCCACACCGGGACCGTTCTCGCCGGCGGCCGCGCTCCCTGCCGCGCCGTGCAACGCCGGACGGGGTTCGTGGCGCAGGACGACGTGCTCCACCCGCACCTCACCGTCCGCGAGACGCTCACCTTCTGCGCGATGCtgcgcctgccccggtcggcgcccggcgccgccaaggcggccgccgccgaggccgTGATCGCGGAGCTCGGGCTGTCGGCGTGCGCCGACACCATCGTCGGGAACGCCTTCGTCCGGGGCGTCTCCGGCGGGGAGCGCAAGCGGGTCAGCATCGGGCACGAGCTGCTGGTGAACCCGAGCCTGCTGGTGCTGGACGAGCCCACGTCGGGGCTCGACTCCACCGCCGCGGCGAGGCTCGTCGCCACGCTGTCGGCGCTGGCGAGGAGAGGACGGACGGTGGTGCTGTCCGTGCACCAGCCGTCGTCGCGGGTGTACCGGATGTTCGACTCCGTGCTGCTCCTCGCCGACGGCAGCTGCCTCTACTTCGGCGCCGGAAGGGACGCCATGGACTACTTCGCGTCGGCCGGATTCGCGCCGGGGTTCCATGTCAACCCGGCTGACTTCATGCTCGACCTCGCCAATGGTTTTGCTCAAGCAGATTACAACGTCACGGCAGAAGGCGGCAATAACGTGAAGCAGTCGCTGATCTCGTCCTACAACAAGGTGCTGGCCCCAAGGGTGAAGGCCTCCATCGTCGCCGCCGATCACGCGCAGAGTGGCGACGGCGAGCAGGTGCCGCCGCCGGCAGAGAGCTGCAGCAGCACGAGCTGGTGCAACCAGTTCACGATCCTGCTCCAGCGCAGCCTCAAGGAGCGTCGCCACGAGACGTTCACGTCGCTGCGCATCTTCCAGATCATGGCGCCGGCGCTGGTGGCCGGCGCCATGTGGTGGCGGTCGACGCCGGTGGCGGTGCAGGACCGGCTGGGCCTGCTCTTCTTCGTCTCCATCTTCTGGGGCGTCTTCGCCTCCTTCAACGCCGTCTTCGCCTTCCCGCAGGAGCGGCCGGTCCTCGCCCGGGAGCGCGCGTCGGGGATGTACGCGCTCTCCTCCTACTTCATGTCGCGCATGGCGGGGGACCTCCCCATGGAGCTCGCCCTCCCCACGGCGTTCACCGTCGTCGTCTACCTCATGGCCGCGCTCAACCCTTCCCCCGCCGCGTTCGCGCTCACGCTCGCCGTCATCCTGGGCTACGTGCTCGTCGCCGAGGGCTTGGGGCTCGCCGTCGGCGCCGTCATGATGGACGCCAAGCGCGCGTCGACTCTTGTCACGGTGATCATGCTGGCGTACCTCCTCACCGGCGGGTTCTACGTCCACAACGTGCCGGAGTTCATGGTGTGGGCCAAGTACACCTCCTTCACCTACTACTGCTACCGCCTCCTCATCGCCGTGCAGTACGGCGGGCACCTCAAGCGCCTGCTCCCGCCGGAGGCCGTCGACGGCGAGGCCGGACCGGGGGCCTGCGTCGCCGCGCTCGTCGCCATGTTCTTCGGCTACCGGCTTCTGGCGTACCTCGCCCTCCGCCGCGTCAGGAAGTGATCGGTCTGATCTGACCTGACCTGACCTGACCCCCGCCGGCGTCAGCACCTGCTGCTGTAGGTAGCTAGCTAGGGACGTGTCTGTCCATTAACTATTCCGGCTGGCCGGCCGGTAACATTGAAGGCGAGGTCCGGCCGCCGCGCGCGGCGAAACCGATCGACCGGGATCCGTGGCTCAGGAGGGCAGGCCGGCGTCGAAGGAGATGATTTGACCACAAATGACGCGGTTGTTGTTGCATCGGCGTCGCCGGGGATCGACGCGAAGGTCGTCTTCTTCGTTCTCCCGCCGCGATTTGTTTCTTTTTTTCACCCTTTTCTCTTACCTATAAGTTTGGTGGTCAACAATGTGCCATCGATCGAGATGCCTTGTTTGCAAGTGTATTATATATtgatgatgatgatgatgaATCAGCGAGTGTAAGCTCAAGCTGTGAGAGCTGATTTGTTTGGGCTTCTTGATGATCTGGTGATGATCGACGAATTGATAATGAGATTGATTTTTAAAGTTTT


Protein sequences

Name Description Sequence
Sbi.14863 translated coding region predicted by ESTScan from UniGene Sbi.14863

MPPNAHQDAHGSNAGGLAVTTTSPPAAASNSKMDCFWTTACTPLNLQFIDVSYRVKQTTDRSSPSSSKAPPPGGRISAHSGSGAPASSAAEERTILKGITGEARPGEVLAVLGPSGSGKSTLLSILGGRRLAGRHTGTVLAGGRAPCRAVQRRTGFVAQDDVLHPHLTVRETLTFCAMLRLPRSAPGAAKAAAAEAVIAELGLSACADTIVGNAFVRGVSGGERKRVSIGHELLVNPSLLVLDEPTSGLDSTAAARLVATLSALARRGRTVVLSVHQPSSRVYRMFDSVLLLADGSCLYFGAGRDAMDYFASAGFAPGFHVNPADFMLDLANGFAQADYNVTAEGGNNXEAVADLVLQQGAGPKGEGLHRRRRSRAEWRRRAGAAAGRELQQHELVQPVHDPAPAQPQGASPRDVHVAAHLPDHGAGAGGRRHVVAVDAGGGAGPAGPLFFVSIFWGVFASFNAVFAFPQERPVLARERASGMYALSSYFMSRMAGDLPMELALPTAFTVVVYLMAALNPSPAAFALTLAVILGYVLVAEGLGLAVGAVMMDAKRASTLVTVIMLAYLLTGGFYVHNVPEFMVWAKYTSFTYYCYRLLIAVQYGGHLKRLLPPEAVDGEAGPGACVAALVAMFFGYRLLAYLALRRVRK

Domains

Domain Start-End Description Sequence

Seg: seg
20-29 seg

TTTSPPAAAS

HMMPanther: PTHR19241:SF23
38-649 ATP-BINDING CASSETTE TRANSPORTER,ATP-BINDING CASSETTE TRANSPORTER

TTACTPLNLQFIDVSYRVKQTTDRSSPSSSKAPPPGGRISAHSGSGAPASSAAEERTILKGITGEARPGEVLAVLGPSGSGKSTLLSILGGRRLAGRHTGTVLAGGRAPCRAVQRRTGFVAQDDVLHPHLTVRETLTFCAMLRLPRSAPGAAKAAAAEAVIAELGLSACADTIVGNAFVRGVSGGERKRVSIGHELLVNPSLLVLDEPTSGLDSTAAARLVATLSALARRGRTVVLSVHQPSSRVYRMFDSVLLLADGSCLYFGAGRDAMDYFASAGFAPGFHVNPADFMLDLANGFAQADYNVTAEGGNNXEAVADLVLQQGAGPKGEGLHRRRRSRAEWRRRAGAAAGRELQQHELVQPVHDPAPAQPQGASPRDVHVAAHLPDHGAGAGGRRHVVAVDAGGGAGPAGPLFFVSIFWGVFASFNAVFAFPQERPVLARERASGMYALSSYFMSRMAGDLPMELALPTAFTVVVYLMAALNPSPAAFALTLAVILGYVLVAEGLGLAVGAVMMDAKRASTLVTVIMLAYLLTGGFYVHNVPEFMVWAKYTSFTYYCYRLLIAVQYGGHLKRLLPPEAVDGEAGPGACVAALVAMFFGYRLLAYLALRRVRK

HMMPanther: PTHR19241
38-649 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

TTACTPLNLQFIDVSYRVKQTTDRSSPSSSKAPPPGGRISAHSGSGAPASSAAEERTILKGITGEARPGEVLAVLGPSGSGKSTLLSILGGRRLAGRHTGTVLAGGRAPCRAVQRRTGFVAQDDVLHPHLTVRETLTFCAMLRLPRSAPGAAKAAAAEAVIAELGLSACADTIVGNAFVRGVSGGERKRVSIGHELLVNPSLLVLDEPTSGLDSTAAARLVATLSALARRGRTVVLSVHQPSSRVYRMFDSVLLLADGSCLYFGAGRDAMDYFASAGFAPGFHVNPADFMLDLANGFAQADYNVTAEGGNNXEAVADLVLQQGAGPKGEGLHRRRRSRAEWRRRAGAAAGRELQQHELVQPVHDPAPAQPQGASPRDVHVAAHLPDHGAGAGGRRHVVAVDAGGGAGPAGPLFFVSIFWGVFASFNAVFAFPQERPVLARERASGMYALSSYFMSRMAGDLPMELALPTAFTVVVYLMAALNPSPAAFALTLAVILGYVLVAEGLGLAVGAVMMDAKRASTLVTVIMLAYLLTGGFYVHNVPEFMVWAKYTSFTYYCYRLLIAVQYGGHLKRLLPPEAVDGEAGPGACVAALVAMFFGYRLLAYLALRRVRK

ProfileScan: PS50893
IPR003439
46-319 ABC_TRANSPORTER_2
ABC transporter-like

LQFIDVSYRVKQTTDRSSPSSSKAPPPGGRISAHSGSGAPASSAAEERTILKGITGEARPGEVLAVLGPSGSGKSTLLSILGGRRLAGRHTGTVLAGGRAPCRAVQRRTGFVAQDDVLHPHLTVRETLTFCAMLRLPRSAPGAAKAAAAEAVIAELGLSACADTIVGNAFVRGVSGGERKRVSIGHELLVNPSLLVLDEPTSGLDSTAAARLVATLSALARRGRTVVLSVHQPSSRVYRMFDSVLLLADGSCLYFGAGRDAMDYFASAGFAPGF

Seg: seg
62-72 seg

SSPSSSKAPPP

Seg: seg
77-90 seg

SAHSGSGAPASSAA

Gene3D: G3DSA:3.40.50.300
91-308 no description

EERTILKGITGEARPGEVLAVLGPSGSGKSTLLSILGGRRLAGRHTGTVLAGGRAPCRAVQRRTGFVAQDDVLHPHLTVRETLTFCAMLRLPRSAPGAAKAAAAEAVIAELGLSACADTIVGNAFVRGVSGGERKRVSIGHELLVNPSLLVLDEPTSGLDSTAAARLVATLSALARRGRTVVLSVHQPSSRVYRMFDSVLLLADGSCLYFGAGRDAMD

superfamily: SSF52540
95-305 P-loop containing nucleoside triphosphate hydrolases

ILKGITGEARPGEVLAVLGPSGSGKSTLLSILGGRRLAGRHTGTVLAGGRAPCRAVQRRTGFVAQDDVLHPHLTVRETLTFCAMLRLPRSAPGAAKAAAAEAVIAELGLSACADTIVGNAFVRGVSGGERKRVSIGHELLVNPSLLVLDEPTSGLDSTAAARLVATLSALARRGRTVVLSVHQPSSRVYRMFDSVLLLADGSCLYFGAGRD

HMMSmart: SM00382
IPR003593
105-296 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

PGEVLAVLGPSGSGKSTLLSILGGRRLAGRHTGTVLAGGRAPCRAVQRRTGFVAQDDVLHPHLTVRETLTFCAMLRLPRSAPGAAKAAAAEAVIAELGLSACADTIVGNAFVRGVSGGERKRVSIGHELLVNPSLLVLDEPTSGLDSTAAARLVATLSALARRGRTVVLSVHQPSSRVYRMFDSVLLLADGS

HMMPfam: PF00005
IPR003439
120-247 ABC_tran
ABC transporter-like

STLLSILGGRRLAGRHTGTVLAGGRAPCRAVQRRTGFVAQDDVLHPHLTVRETLTFCAMLRLPRSAPGAAKAAAAEAVIAELGLSACADTIVGNAFVRGVSGGERKRVSIGHELLVNPSLLVLDEPTS

Seg: seg
185-199 seg

APGAAKAAAAEAVIA

Seg: seg
370-389 seg

RRRRSRAEWRRRAGAAAGRE

Seg: seg
422-448 seg

PDHGAGAGGRRHVVAVDAGGGAGPAGP

HMMPfam: PF01061
IPR013525
449-603 ABC2_membrane
ABC-2 type transporter

LFFVSIFWGVFASFNAVFAFPQERPVLARERASGMYALSSYFMSRMAGDLPMELALPTAFTVVVYLMAALNPSPAAFALTLAVILGYVLVAEGLGLAVGAVMMDAKRASTLVTVIMLAYLLTGGFYVHNVPEFMVWAKYTSFTYYCYRLLIAVQY

Seg: seg
636-648 seg

YRLLAYLALRRVR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox