PRGDB00076609 (Sbi.15617)

From PRG Wiki
Jump to: navigation, search
Sbi.15617
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 242048311 (XM_002461857)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Sorghum bicolor

Comment?

Sorghum bicolor hypothetical protein, mRNA

DNA Sequence

CAGACTTTCCAGTTTCACTTGGGGACAGCACGCACCGCAGTCCGCAGCGTCTTTCCCTTCTGCTCGTCCTCCGCCTCCGTCGCAGGTGCCGGCGCTAAGCGAGGATCCCTCCGCCCCTCCCTCCGGCCGTCCGTCCCGACGGGACCTCGACTGGTATCGTCGGTCGCTGTGGCGACAGGTGACGGGACGGCGATATGAAGTGGTTATGTTGTAACTGCCATGTTGATGACGAGGAAGATGGCCACGACATGGAACAGGCCAAAACTCAGAGCAATAAGATAGACCCCAAGCAGAAGTCTTCAAAACCTCCTGTTAGTCAACCTGAGCCAGAGTTCTCCCCTCCTACAATTGATGTCCCTGAATTGTCGTTGGATGATTTGAAACAAAAGACTGATGATTTTGGATCAAGCGCTCTGATTGGTGAAGGTTCTTATGGACGAGTGTATCATGCTACTTTGGATGATGGGAGGCAAGCGGCAGTTAAAAAGCTTGATGCATCTGAAAATGAGCCTAATGATGAGTTCCTGAAACAGGTCTCACTGGCATCAAAGCTAAAACATGAAAATCTTGTTGAGATGTTGGGTTACTGTGTGGATGGGAATTATCGTATACTTGCATATGAATTTGCAACCATGGGTTCGCTTCATGATGTTTTACATGGAAGAAAAGGCGTTCAAGGCGCGCAGCCTGGACCTGTACTTGACTGGATGCAAAGGGTCAAAATTGCTATTGAGGCTGCAAAAGGTATAGAATATCTGCATGAAAAGGTTCAGCCTTCAATCATCCATCGGGACATCAGATCAAGCAATGTACTGCTGTTTGAGGATTTCAAGGCAAAAATTGCAGACTTCAATCTTTTGAACCAAGCACCAGATATGGCAGCTCGGCTCCATTCAACTCGTGTATTGGGAACTTTTGGATATCACGCACCTGAATATGCTATGACTGGTCAGCTGACACAGAAAAGCGATGTCTACAGCTTTGGTGTAGTTCTTTTGGAACTTTTGACTGGAAGGAAACCAGTAGATCACACAATGCCTCGAGGACAACAAAGTTTAGTCACATGGGCTACTCCAAGGTTAAGTGAAGACAAGGTGAAGCAATGTGTGGATCCCAGGTTGAAGGGAGAATATCCTCCAAAGGGAGTCGCTAAGCTTGCTGCAGTGGCAGCTCTATGCGTTCAATACGAAGCAGAGTTCAGGCCCAACATGAGCATAGTTGTGAAGGCGCTTTCGCCTCTCCTTCAACAAAGACCTGCACCAGCCACCGCAGAGCCAGCCCCGCAACCTGTGAGCTGAAACCAGTCATATGTGATGGGACCCTCGGCATGCATTCAACCAGCACATTCTATGAGTCATTGAGAGTATTTTGGCTATTTGTTCTGTAGCATTCTCAGTTGGGTACAGCATACATGAACTTGCCTCTACTGTTTGTGGACAACAACAGTTCGTGGCTTGATGTTGGCGCCACACAATGGTATATGCAGTAGGCTCGAAGTTGTTTTTTTACCTTCTCTACCAATACCAACTGTTTGTAGGTTTCAGAATTCGTTGCTTGAAGAATGATGCAGAATGATCTGGACTTTTTACCTTTGGCGTGGCGTTGCTGCCTTGCCTTCCATGCTGGTTATCATGAACTTCCTCCCAAATCACAATTCACTTTTAATTTGTTGTAAGCCAAAATTCTTAAACTGTGATCAAGTTTATGAAATATAGATATGGACGTCTAAAAC


Protein sequences

Name Description Sequence
Sbi.15617 translated coding region predicted by ESTScan from UniGene Sbi.15617

XRLSSFTWGQHAPQSAASFPSARPPPPSQVPALSEDPSAPPSGRPSRRDLDWYRRSLWRQVTGRRYEVVMLNCHVDDEEDGHDMEQAKTQSNKIDPKQKSSKPPVSQPEPEFSPPTIDVPELSLDDLKQKTDDFGSSALIGEGSYGRVYHATLDDGRQAAVKKLDASENEPNDEFLKQVSLASKLKHENLVEMLGYCVDGNYRILAYEFATMGSLHDVLHGRKGVQGAQPGPVLDWMQRVKIAIEAAKGIEYLHEKVQPSIIHRDIRSSNVLLFEDFKAKIADFNLLNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALSPLLQQRPAPATAEPAPQPVSXNQSYVMGPSACIQPAHSMSH

Domains

Domain Start-End Description Sequence

Seg: seg
12-34 seg

APQSAASFPSARPPPPSQVPALS

Seg: seg
37-48 seg

PSAPPSGRPSRR

superfamily: SSF56112
IPR011009
106-434 Protein kinase-like (PK-like)
Protein kinase-like domain

SQPEPEFSPPTIDVPELSLDDLKQKTDDFGSSALIGEGSYGRVYHATLDDGRQAAVKKLDASENEPNDEFLKQVSLASKLKHENLVEMLGYCVDGNYRILAYEFATMGSLHDVLHGRKGVQGAQPGPVLDWMQRVKIAIEAAKGIEYLHEKVQPSIIHRDIRSSNVLLFEDFKAKIADFNLLNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALSPLLQQRPAPATAEPAPQPVSXN

HMMPanther: PTHR24420:SF416
107-429 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

QPEPEFSPPTIDVPELSLDDLKQKTDDFGSSALIGEGSYGRVYHATLDDGRQAAVKKLDASENEPNDEFLKQVSLASKLKHENLVEMLGYCVDGNYRILAYEFATMGSLHDVLHGRKGVQGAQPGPVLDWMQRVKIAIEAAKGIEYLHEKVQPSIIHRDIRSSNVLLFEDFKAKIADFNLLNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALSPLLQQRPAPATAEPAPQ

HMMPanther: PTHR24420
107-429 FAMILY NOT NAMED,FAMILY NOT NAMED

QPEPEFSPPTIDVPELSLDDLKQKTDDFGSSALIGEGSYGRVYHATLDDGRQAAVKKLDASENEPNDEFLKQVSLASKLKHENLVEMLGYCVDGNYRILAYEFATMGSLHDVLHGRKGVQGAQPGPVLDWMQRVKIAIEAAKGIEYLHEKVQPSIIHRDIRSSNVLLFEDFKAKIADFNLLNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALSPLLQQRPAPATAEPAPQ

Gene3D: G3DSA:3.30.200.20
119-209 no description

VPELSLDDLKQKTDDFGSSALIGEGSYGRVYHATLDDGRQAAVKKLDASENEPNDEFLKQVSLASKLKHENLVEMLGYCVDGNYRILAYEF

ProfileScan: PS50011
IPR000719
134-415 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FGSSALIGEGSYGRVYHATLDDGRQAAVKKLDASENEPNDEFLKQVSLASKLKHENLVEMLGYCVDGNYRILAYEFATMGSLHDVLHGRKGVQGAQPGPVLDWMQRVKIAIEAAKGIEYLHEKVQPSIIHRDIRSSNVLLFEDFKAKIADFNLLNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALSPLL

HMMSmart: SM00220
IPR002290
134-415 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FGSSALIGEGSYGRVYHATLDDGRQAAVKKLDASENEPNDEFLKQVSLASKLKHENLVEMLGYCVDGNYRILAYEFATMGSLHDVLHGRKGVQGAQPGPVLDWMQRVKIAIEAAKGIEYLHEKVQPSIIHRDIRSSNVLLFEDFKAKIADFNLLNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALSPLL

HMMSmart: SM00219
IPR020635
134-411 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FGSSALIGEGSYGRVYHATLDDGRQAAVKKLDASENEPNDEFLKQVSLASKLKHENLVEMLGYCVDGNYRILAYEFATMGSLHDVLHGRKGVQGAQPGPVLDWMQRVKIAIEAAKGIEYLHEKVQPSIIHRDIRSSNVLLFEDFKAKIADFNLLNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKAL

HMMPfam: PF07714
IPR001245
139-411 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

LIGEGSYGRVYHATLDDGRQAAVKKLDASENEPNDEFLKQVSLASKLKHENLVEMLGYCVDGNYRILAYEFATMGSLHDVLHGRKGVQGAQPGPVLDWMQRVKIAIEAAKGIEYLHEKVQPSIIHRDIRSSNVLLFEDFKAKIADFNLLNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKAL

PatternScan: PS00107
IPR017441
140-163 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGSYGRVYHATLDDGRQAAVKK

Gene3D: G3DSA:1.10.510.10
213-410 no description

GSLHDVLHGRKGVQGAQPGPVLDWMQRVKIAIEAAKGIEYLHEKVQPSIIHRDIRSSNVLLFEDFKAKIADFNLLNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKA

PatternScan: PS00109
IPR008266
261-273 PROTEIN_KINASE_TYR
Tyrosine-protein kinase, active site

IIHRDIRSSNVLL

Seg: seg
379-392 seg

PPKGVAKLAAVAAL

Seg: seg
416-430 seg

QQRPAPATAEPAPQP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox