PRGDB00076627 (Sbi.17079)

From PRG Wiki
Jump to: navigation, search
Sbi.17079
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 242072058 (XM_002451261)
Gene Class N
Domain Type NBS
Gene Species Sorghum bicolor

Comment?

Sorghum bicolor hypothetical protein, mRNA

DNA Sequence

ATGGCGGGCACGCCGTCGCCGTTGCCGCGGTGGGCGCCGACGCCGAGCCCCTCGTGGCCGCTCTGGCGCTGGGGCGGCGGCGGCACGCCTGACGACGCTAACAACCATCATCAGCCCGGCGGCCGAGGCTGGTGGTGGTCGTCGTCGTCGCTCCCGAGCGGCGGCGTCCCCGGACGATCGGGGTGCGAGCTGCAGGTTGTTGAGGTGCCATCGTCGGCGGACGCGGACGCGGACGCCGGCGGTGGTGACCCCAGGGCGTTCCTGACGTGGGAGGACGTGCGCGTGACGGTGGCCGGCGGCGGCGGCCCGCGTGGGGCGCCGGACGTGAGGATCCTCGACGGGATCAGCGGGCATGCGCGGCCCGGGGAGGTGGTCGCCATCATGGGCCCCTCTGGCGGCGGCAAGACCACGCTGCTCGACACCCTCGCTGGAAGGCTAGGACCAGGCATGAATAAAAAAGGGCTGATTTTAATCAATGGCCGCCAGGAGAAGCTTGCCTATGGAACCTCGGCCTACGTGACCCAAGACAACGTGCTGATGTCAACGCTGTCGGTGCGGGAGGCGGTGTACTACTCGGCGCAGCTGCAGCTGCCGGACACGATGCCGTTGCCGGAGAAGCGGGCGCACGCGGAGCGGGTGATCCGGGAGTTGGGTCTCGGCGACGCCATGGACACGCGCGTCGGCGGCCGGATCACCAAGGGCATCAGCGGCGGGCAGCGGAAGCGGCTCAGCATCTGCATCGAGATGCTCACGCGGCCGCGCCTGCTCTTCCTCGACGAGCCCACCAGCGGCCTCGACAGCGCCGCCTCCTACCACGTCATGAGCCACATCGCCCGCGTCGCCGCCCGCGACGACATGACGGTCGTCGCCGCCGTGCACCAGCCCAGCGGCGACGTCTTCGAGCTCTTCCATGGCCTCTGCTTGCTCGCCGCCGGCAGGACGGTCTTCTTTGGGACCATCTCTGATGCCACCGAGTTCTTTACTCTGAACGGATTTCCATGTCCACACCTGAGAAGCCCGTCAGATCACTTCCTGAGAACAATCAACAAAGACTTTGATGAGGAAACCGTAGAGAGCTCTAAAACTCAAAGGAAAACAGCAGCTGAAGCAATAGAAATTCTGGCGACTGCATACAGATCCTCCGATTATATCGAAAAAACGACAAACCAAATTGTTGAAATGAAAAACATGGATGGAGCTTCATTTAGGAGGAGAGAACAAGCAAGCTTCGCCACAAAGCTCCTTGTGCTCACAAGGAGGTCATTCCTGAATATGCACAGGGACATAGGATATTACTGGATGCGTTTGGGCATCTATATGGGCATTGGCGTATGTCTAGGCACTATCTTCTACCAAGTTGGCTATAGCTACAGTTCTATCCAGAGCCGATGTTCAGTAATAATGTATACAGTTGCACTTTTAACTTTCATGTCTATTGGAGGATTTCCATCTTTTGTGGAAGACGTAAAGGTCTTCAGAAAGGAGAGGCTTAGTGGCCACTATGGTGTGTCAGAATTTGTGATCTCAAACACCCTCTCAGCTACTCCTTACCTATCTGTGATTGCTGTATTACCCGGCGCAATGCTTTACTATCTCACCGGACTAACCAAAGGCGTGGATCACTTCATCTATTTCGTCATTGTCGTTTGCCTATGTTGCCTTCTAGTTGAGAGCATGATGATGGTTATCGCCGCGATTGTTCCGGACTTCCTTATGGGGATCATCGTTGGAGCTGGAGTGCAGGGGGTGATGATGCTCAATGGGGGCTTCTTCCGCCTTCCTAATGAGCTCCCAAAGCCTGTATGGAAGTACCCTTCCTACTACATCTCCTTCCATAAGTATGCAGTGCAAGGGCTCTACAAGAACGAGTTCATGGGGCTCTCTTTCCCAAGTGATCAGCTGATTGAATCCAATGTCACCATCAGTGGCATTCAGGTCCTGAAGAAAAACTTGCAGGTGGAGATGGGGTACTCGAAATGGGTGAACCTTGCCATCCTTTGTGGAATGATGGTGATATACAGGATGATGTTCTTCGCTATCGTCAAGATTACCGAGGAAATTCGACAAAAAAGGGGAGGCAAACGAGGATGTGTTAGATAG


Protein sequences

Name Description Sequence
Sbi.17079 translated coding region predicted by ESTScan from UniGene Sbi.17079

MAGTPSPLPRWAPTPSPSWPLWRWGGGGTPDDANNHHQPGGRGWWWSSSSLPSGGVPGRSGCELQVVEVPSSADADADAGGGDPRAFLTWEDVRVTVAGGGGPRGAPDVRILDGISGHARPGEVVAIMGPSGGGKTTLLDTLAGRLGPGMNKKGLILINGRQEKLAYGTSAYVTQDNVLMSTLSVREAVYYSAQLQLPDTMPLPEKRAHAERVIRELGLGDAMDTRVGGRITKGISGGQRKRLSICIEMLTRPRLLFLDEPTSGLDSAASYHVMSHIARVAARDDMTVVAAVHQPSGDVFELFHGLCLLAAGRTVFFGTISDATEFFTLNGFPCPHLRSPSDHFLRTINKDFDEETVESSKTQRKTAAEAIEILATAYRSSDYIEKTTNQIVEMKNMDGASFRRREQASFATKLLVLTRRSFLNMHRDIGYYWMRLGIYMGIGVCLGTIFYQVGYSYSSIQSRCSVIMYTVALLTFMSIGGFPSFVEDVKVFRKERLSGHYGVSEFVISNTLSATPYLSVIAVLPGAMLYYLTGLTKGVDHFIYFVIVVCLCCLLVESMMMVIAAIVPDFLMGIIVGAGVQGVMMLNGGFFRLPNELPKPVWKYPSYYISFHKYAVQGLYKNEFMGLSFPSDQLIESNVTISGIQVLKKNLQVEMGYSKWVNLAILCGMMVIYRMMFFAIVKITEEIRQKRGGKRGCVR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR19241:SF20
7-695 PTHR19241:SF20,ATP-BINDING CASSETTE TRANSPORTER PLANT

PLPRWAPTPSPSWPLWRWGGGGTPDDANNHHQPGGRGWWWSSSSLPSGGVPGRSGCELQVVEVPSSADADADAGGGDPRAFLTWEDVRVTVAGGGGPRGAPDVRILDGISGHARPGEVVAIMGPSGGGKTTLLDTLAGRLGPGMNKKGLILINGRQEKLAYGTSAYVTQDNVLMSTLSVREAVYYSAQLQLPDTMPLPEKRAHAERVIRELGLGDAMDTRVGGRITKGISGGQRKRLSICIEMLTRPRLLFLDEPTSGLDSAASYHVMSHIARVAARDDMTVVAAVHQPSGDVFELFHGLCLLAAGRTVFFGTISDATEFFTLNGFPCPHLRSPSDHFLRTINKDFDEETVESSKTQRKTAAEAIEILATAYRSSDYIEKTTNQIVEMKNMDGASFRRREQASFATKLLVLTRRSFLNMHRDIGYYWMRLGIYMGIGVCLGTIFYQVGYSYSSIQSRCSVIMYTVALLTFMSIGGFPSFVEDVKVFRKERLSGHYGVSEFVISNTLSATPYLSVIAVLPGAMLYYLTGLTKGVDHFIYFVIVVCLCCLLVESMMMVIAAIVPDFLMGIIVGAGVQGVMMLNGGFFRLPNELPKPVWKYPSYYISFHKYAVQGLYKNEFMGLSFPSDQLIESNVTISGIQVLKKNLQVEMGYSKWVNLAILCGMMVIYRMMFFAIVKITEEIRQKRGGKR

HMMPanther: PTHR19241
7-695 PTHR19241,ATP-BINDING CASSETTE TRANSPORTER

PLPRWAPTPSPSWPLWRWGGGGTPDDANNHHQPGGRGWWWSSSSLPSGGVPGRSGCELQVVEVPSSADADADAGGGDPRAFLTWEDVRVTVAGGGGPRGAPDVRILDGISGHARPGEVVAIMGPSGGGKTTLLDTLAGRLGPGMNKKGLILINGRQEKLAYGTSAYVTQDNVLMSTLSVREAVYYSAQLQLPDTMPLPEKRAHAERVIRELGLGDAMDTRVGGRITKGISGGQRKRLSICIEMLTRPRLLFLDEPTSGLDSAASYHVMSHIARVAARDDMTVVAAVHQPSGDVFELFHGLCLLAAGRTVFFGTISDATEFFTLNGFPCPHLRSPSDHFLRTINKDFDEETVESSKTQRKTAAEAIEILATAYRSSDYIEKTTNQIVEMKNMDGASFRRREQASFATKLLVLTRRSFLNMHRDIGYYWMRLGIYMGIGVCLGTIFYQVGYSYSSIQSRCSVIMYTVALLTFMSIGGFPSFVEDVKVFRKERLSGHYGVSEFVISNTLSATPYLSVIAVLPGAMLYYLTGLTKGVDHFIYFVIVVCLCCLLVESMMMVIAAIVPDFLMGIIVGAGVQGVMMLNGGFFRLPNELPKPVWKYPSYYISFHKYAVQGLYKNEFMGLSFPSDQLIESNVTISGIQVLKKNLQVEMGYSKWVNLAILCGMMVIYRMMFFAIVKITEEIRQKRGGKR

Gene3D: G3DSA:3.40.50.300
87-323 G3DSA:3.40.50.300

FLTWEDVRVTVAGGGGPRGAPDVRILDGISGHARPGEVVAIMGPSGGGKTTLLDTLAGRLGPGMNKKGLILINGRQEKLAYGTSAYVTQDNVLMSTLSVREAVYYSAQLQLPDTMPLPEKRAHAERVIRELGLGDAMDTRVGGRITKGISGGQRKRLSICIEMLTRPRLLFLDEPTSGLDSAASYHVMSHIARVAARDDMTVVAAVHQPSGDVFELFHGLCLLAAGRTVFFGTISDA

superfamily: SSF52540
87-340 SSF52540

FLTWEDVRVTVAGGGGPRGAPDVRILDGISGHARPGEVVAIMGPSGGGKTTLLDTLAGRLGPGMNKKGLILINGRQEKLAYGTSAYVTQDNVLMSTLSVREAVYYSAQLQLPDTMPLPEKRAHAERVIRELGLGDAMDTRVGGRITKGISGGQRKRLSICIEMLTRPRLLFLDEPTSGLDSAASYHVMSHIARVAARDDMTVVAAVHQPSGDVFELFHGLCLLAAGRTVFFGTISDATEFFTLNGFPCPHLRSP

ProfileScan: PS50893
IPR003439
88-336 ABC_TRANSPORTER_2
ABC transporter-like

LTWEDVRVTVAGGGGPRGAPDVRILDGISGHARPGEVVAIMGPSGGGKTTLLDTLAGRLGPGMNKKGLILINGRQEKLAYGTSAYVTQDNVLMSTLSVREAVYYSAQLQLPDTMPLPEKRAHAERVIRELGLGDAMDTRVGGRITKGISGGQRKRLSICIEMLTRPRLLFLDEPTSGLDSAASYHVMSHIARVAARDDMTVVAAVHQPSGDVFELFHGLCLLAAGRTVFFGTISDATEFFTLNGFPCPH

HMMSmart: SM00382
IPR003593
121-322 AAA,NBS
ATPase, AAA+ type, core

PGEVVAIMGPSGGGKTTLLDTLAGRLGPGMNKKGLILINGRQEKLAYGTSAYVTQDNVLMSTLSVREAVYYSAQLQLPDTMPLPEKRAHAERVIRELGLGDAMDTRVGGRITKGISGGQRKRLSICIEMLTRPRLLFLDEPTSGLDSAASYHVMSHIARVAARDDMTVVAAVHQPSGDVFELFHGLCLLAAGRTVFFGTISD

HMMPfam: PF00005
IPR003439
136-263 ABC_tran
ABC transporter-like

TTLLDTLAGRLGPGMNKKGLILINGRQEKLAYGTSAYVTQDNVLMSTLSVREAVYYSAQLQLPDTMPLPEKRAHAERVIRELGLGDAMDTRVGGRITKGISGGQRKRLSICIEMLTRPRLLFLDEPTS

PatternScan: PS00211
IPR017871
235-249 ABC_TRANSPORTER_1
ABC transporter, conserved site

ISGGQRKRLSICIEM

HMMPfam: PF01061
IPR013525
413-624 ABC2_membrane
ABC-2 type transporter

KLLVLTRRSFLNMHRDIGYYWMRLGIYMGIGVCLGTIFYQVGYSYSSIQSRCSVIMYTVALLTFMSIGGFPSFVEDVKVFRKERLSGHYGVSEFVISNTLSATPYLSVIAVLPGAMLYYLTGLTKGVDHFIYFVIVVCLCCLLVESMMMVIAAIVPDFLMGIIVGAGVQGVMMLNGGFFRLPNELPKPVWKYPSYYISFHKYAVQGLYKNEF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox