PRGDB00076637 (Sbi.18346)

From PRG Wiki
Jump to: navigation, search
Sbi.18346
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 242070684 (XM_002450574)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Sorghum bicolor

Comment?

Sorghum bicolor hypothetical protein, mRNA

DNA Sequence

ACAACACAACACAACGCGCCGTTGACTGACTTTGCTCGCGTCGCCGCCTCGTCTTGAGTCGAGTCATCTCGCTTCCCTCGTCTCGATCCAGATCCCGTGTTCCCGCGGGTTCATTCGTTTATATATAATCTTCaaaaaaaaGCCCTGCAGCTCAAGCTTCATCCCGCGTCCCGCCAGCAATTTCAGATTTTCAGCTCCTCTGGTTCTTCACTTCTTCAGTCTCTTTCTCGAGCTTGGATCCCTCAAGTGTTCTCCAGGTACAGGCGTACAGCTACTTCAATCGTCAGAAATGGCCACTGATGCCAGTGGAGGTGGTAAGCCTAGTCTTCTGAGTACTTTACCGAAGCAACTACCAGCGGATTTTCTGAAAGAAATTACGAACGGGTTCCATGCTGACCGAAAACTGGGTCAAGGTGCATTTGGAACTGTTTACAAGGGGTTTCTGCAAGATGGGCAACCCATTGCTGTGAAGAAGCTCTCAGATAATTCCCCAGTGGCAACTGACAAACAGTTCAAGAACGAGGTTGGGAACCTTATGGCCATCCAGCATGAGAATATAGTGAGGTTGTATGGCTACTGTCATGAAGCACAGAAGAAAGTGATAGAGCACAATGGAAGGTACATTCTTGTGGATGTGGTTGAGAGCATGCTCTGCTACGAATACGCGCCCAAGGGAAACCTCGACAAGTGTATTTTTGATATGTCTTCTAGGCCTAATTGGGCGACATGCTTCAAAATAATCAAGGGCATCTGCCAGGGTTTATATTTCCTACACAAGGGAATGGACAGGCCTATTGTTCATCTGGACCTTCAGCCTGCCAACATATTGTTGGATGATAACATGGTACCTAAAATTGCAGACTTTGGCCTGTCAAGACTCTTTGGTGAAGAACAAACCCGAATAAATACAATAAATGTTGTGGGAGCAAAAGGGTATATGGCTCCAGAATATCTGTACAGAGGAGAAATCTCAACCCGGTCTGACATATACAGCTTAGGCGTACTAATCATGGAGATCGCAACTGGACAGAAGAACTCTATGAATGACAAAGACATGTCTGGAAGGGACTTTGTAGATCAGGTTCGTCAAACATGGACAGATGAGCACATAGCATCCAAGTACTCATCACTGGACGCAGACAGCCTCCAGCAAGTAAAAACATGCATTGAAACTGGGCTAAAATGTGTGGATATTGATCAGAAGAAGAGACCTTCTATAGTTGAAATTGTTGAGAAGCTCGATGGAAGGCATGCTCGCTGAATGGTGAAGTAGTGTATGTTGTGCAATGTAAAATTGTGGTGCATAGCATAGTTCACCCATGCTGATACACTCAAGATGCAATCATGCGCACAATAATTGTATCACTTACTAATTTATGTAATATGTTGCTTGTGGGTTAGCAATTAGTACTCCCTCCACTCAGTTTTATGTGTCGCTTCAGCTGTGAACAATATGACATTATAATGTCACATAACCCTGAGCTCAGTGTTCATTTTATGACTTTACTTTCAATTATGTATAATCTTATATCCTTTGTATGGCCATATATGGATAACATAATTGTTAATCGTTGATCCTATTCATGGATCGATCTTAGATACAAAGCATATATAATGAGAAGTCATCTTAAATTCTCTGATT


Protein sequences

Name Description Sequence
Sbi.18346 translated coding region predicted by ESTScan from UniGene Sbi.18346

MATDASGGGKPSLLSTLPKQLPADFLKEITNGFHADRKLGQGAFGTVYKGFLQDGQPIAVKKLSDNSPVATDKQFKNEVGNLMAIQHENIVRLYGYCHEAQKKVIEHNGRYILVDVVESMLCYEYAPKGNLDKCIFDMSSRPNWATCFKIIKGICQGLYFLHKGMDRPIVHLDLQPANILLDDNMVPKIADFGLSRLFGEEQTRINTINVVGAKGYMAPEYLYRGEISTRSDIYSLGVLIMEIATGQKNSMNDKDMSGRDFVDQVRQTWTDEHIASKYSSLDADSLQQVKTCIETGLKCVDIDQKKRPSIVEIVEKLDGRHAR

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
5-317 Kinase_like
Protein kinase-like domain

ASGGGKPSLLSTLPKQLPADFLKEITNGFHADRKLGQGAFGTVYKGFLQDGQPIAVKKLSDNSPVATDKQFKNEVGNLMAIQHENIVRLYGYCHEAQKKVIEHNGRYILVDVVESMLCYEYAPKGNLDKCIFDMSSRPNWATCFKIIKGICQGLYFLHKGMDRPIVHLDLQPANILLDDNMVPKIADFGLSRLFGEEQTRINTINVVGAKGYMAPEYLYRGEISTRSDIYSLGVLIMEIATGQKNSMNDKDMSGRDFVDQVRQTWTDEHIASKYSSLDADSLQQVKTCIETGLKCVDIDQKKRPSIVEIVEKL

Gene3D: G3DSA:3.30.200.20
19-94 G3DSA:3.30.200.20

KQLPADFLKEITNGFHADRKLGQGAFGTVYKGFLQDGQPIAVKKLSDNSPVATDKQFKNEVGNLMAIQHENIVRLY

HMMPanther: PTHR24420
26-317 PTHR24420,FAMILY NOT NAMED

LKEITNGFHADRKLGQGAFGTVYKGFLQDGQPIAVKKLSDNSPVATDKQFKNEVGNLMAIQHENIVRLYGYCHEAQKKVIEHNGRYILVDVVESMLCYEYAPKGNLDKCIFDMSSRPNWATCFKIIKGICQGLYFLHKGMDRPIVHLDLQPANILLDDNMVPKIADFGLSRLFGEEQTRINTINVVGAKGYMAPEYLYRGEISTRSDIYSLGVLIMEIATGQKNSMNDKDMSGRDFVDQVRQTWTDEHIASKYSSLDADSLQQVKTCIETGLKCVDIDQKKRPSIVEIVEKL

HMMPanther: PTHR24420:SF762
26-317 PTHR24420:SF762

LKEITNGFHADRKLGQGAFGTVYKGFLQDGQPIAVKKLSDNSPVATDKQFKNEVGNLMAIQHENIVRLYGYCHEAQKKVIEHNGRYILVDVVESMLCYEYAPKGNLDKCIFDMSSRPNWATCFKIIKGICQGLYFLHKGMDRPIVHLDLQPANILLDDNMVPKIADFGLSRLFGEEQTRINTINVVGAKGYMAPEYLYRGEISTRSDIYSLGVLIMEIATGQKNSMNDKDMSGRDFVDQVRQTWTDEHIASKYSSLDADSLQQVKTCIETGLKCVDIDQKKRPSIVEIVEKL

ProfileScan: PS50011
IPR000719
33-323 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FHADRKLGQGAFGTVYKGFLQDGQPIAVKKLSDNSPVATDKQFKNEVGNLMAIQHENIVRLYGYCHEAQKKVIEHNGRYILVDVVESMLCYEYAPKGNLDKCIFDMSSRPNWATCFKIIKGICQGLYFLHKGMDRPIVHLDLQPANILLDDNMVPKIADFGLSRLFGEEQTRINTINVVGAKGYMAPEYLYRGEISTRSDIYSLGVLIMEIATGQKNSMNDKDMSGRDFVDQVRQTWTDEHIASKYSSLDADSLQQVKTCIETGLKCVDIDQKKRPSIVEIVEKLDGRHAR

HMMPfam: PF00069
IPR017442
34-316 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

HADRKLGQGAFGTVYKGFLQDGQPIAVKKLSDNSPVATDKQFKNEVGNLMAIQHENIVRLYGYCHEAQKKVIEHNGRYILVDVVESMLCYEYAPKGNLDKCIFDMSSRPNWATCFKIIKGICQGLYFLHKGMDRPIVHLDLQPANILLDDNMVPKIADFGLSRLFGEEQTRINTINVVGAKGYMAPEYLYRGEISTRSDIYSLGVLIMEIATGQKNSMNDKDMSGRDFVDQVRQTWTDEHIASKYSSLDADSLQQVKTCIETGLKCVDIDQKKRPSIVEIVEK

PatternScan: PS00107
IPR017441
39-62 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGQGAFGTVYKGFLQDGQPIAVKK

Gene3D: G3DSA:1.10.510.10
95-316 G3DSA:1.10.510.10

GYCHEAQKKVIEHNGRYILVDVVESMLCYEYAPKGNLDKCIFDMSSRPNWATCFKIIKGICQGLYFLHKGMDRPIVHLDLQPANILLDDNMVPKIADFGLSRLFGEEQTRINTINVVGAKGYMAPEYLYRGEISTRSDIYSLGVLIMEIATGQKNSMNDKDMSGRDFVDQVRQTWTDEHIASKYSSLDADSLQQVKTCIETGLKCVDIDQKKRPSIVEIVEK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox