PRGDB00076890 (Sof.40)

From PRG Wiki
Jump to: navigation, search
Sof.40
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 30109841 (BQ804048)
Gene Class NL
Domain Type NBS, LRR
Gene Species Saccharum officinarum

Comment?

SCJLRZ1018G01.g Saccharum officinarum mRNA Saccharum officinarum cDNA, mRNA sequence

DNA Sequence

GAGCCTTTAAAAACACAGCTTTGTGTCCCCAAGAGCTTGAGGATGTGGCTGCTTCCATAGTAGAAAGGTGTAAGGGCTTGCCATTGGCACTTATATCTATGGGCAGCCTCATGTCCTCCAAGAAACCAACTAAACATGCCTGGAATCAAATGTACAATCAGTTCCGGGTTGAACTAGCTAAACCAGACAATGTGCAGGCAATTTTGAAGCTTAGCTACAATGATTTACCAGGGGACCTCAGAAACTGTTTCCTATACTGCAGCCTATTTCCTGAAGATTGCATCATGTCAAGGGAGAGCCTTGTCAGGCAGTGGGTTGCTGAAGGATTTGCAGTGACCAAGGAAAACAACACACTGGAGGATGTGGCTGAGCTAAATCTGGTGGAGCTCATTACTAGGAACTTGCTGCAAGTTGAAGAGTATGATGAGCTTGGTAGGGTGAACACATGTAAGATGCATGACATTGTGCGTGACCTGGCTCTTTCAATAGCTAGAGATGAAAAGTTTGGCTCTGCAAGCGATCAGGCTGCAGTGATAAATATGGACCGGGAAGTGCGCCGACTATCATTGTGTCAATGGAATGACAGTGATGCACCAAGAGTGAAATTTCCACACCTTCGCACTCTATTTTCACTTGATGGTGTTACATCCGCTCACATGCTAGCCTCAATCTTTTCTGAGTCAAGCTACCTTACTGTTCTTGAGCTACAAGATTCTGAGATAACCGAAGTGCCACAATCTATAGGTAATCTGTTTAATCTACGTTACATTGGCTTGCGGCGCACAGGAGTCAAGTCGCTCCCAGAGTGTATTGAGAAGCTATCCAACCTACAGACACTGGACATCAAACAAACAAAAATAGAGAAGCTACCAAGAGGCATAGTCAAGGTTAAGAAGCTGCGGCATCTGTTAGCTGACAGAGTGGTGGATGAGAAGCAGAAAGATTTCGGGTACTTCACAGGGGTACAGCCACCCAAGGACCTCTCTAATTTGGTGGAACTTCAGACTCTGGAGACTGTGGAAGCAACAAATGACTTGGCAGGCCAACTGGACAACCTCAGAAAACTAAAAAGCGTGTGGGTTTGCAAAGTTACTGCCATCCATTCTGCAGATCTTTTTCCTGCAGTATCTAAGCTGCCACTTCTTGCCTGTTTGCTTCTTAATGCAAGTGATGAGGAGCAGACACTGCACTTGGAAACTCTCAACCCACAGTCCAAGCAGTTCCACAGGTTGATCGTCAGGGGCCGCTGGGCTGCGGGAACACTGCAGTGCCCAATATTTCGAGGCCATGGGAAAAACCTCAAGTATCTAGCTCTAAGCTGGTCTGGTCTTCAGGAAGACCCGCTACTACTTATTGCTCCACATGTACCAAACCTCACCTATCTGAGTCTTAACAGGGTGAGCAGCACAGAGACAATGGTTATTTCTGAAGGGTCCTTTCCACAGCTAAAGACACTAATACTGAAGAATATGCTCAATGTCAACCAGTTGACAGTTGGGAAGGATGCTCTTCCAAATATTGAAGGTTTATATATTGTGGCGCTGCCGAAACTGAATAAGGTTCCTGAAGGATTTGAATCCCTTGTGTCTTTAAGGAAGCTGTGGTTACTGTCTCTGCATAAGGATTTCAAAATCCTGTGGGAGCTAAGTAGAATGCGCCAGAAGATGCCACATGTGGTGGAGGTTCGCGTCGAGTGATCGCCTGCTTCTTCATGCAACAATACTTCTGATTATTTATGCGTATAGTCCTTTGTCTTTGATTCTTCCAGAAGATCTGCAATTCTGAATGTTTTTGTGGCTTGTGTTTTTCCTTTCAATAAGTCTGGAACAAACAGATCTCCTCACCAAGAATGTGCCTGATAGTTTGTGTATGCCATGTCATTGTGGTTTCTTTGTAGTTTGATTTTCCTTTTTAATGTATGAACCATGTCATTGAACTGGCCGATTTGACAATAAAATTTTCTCTGTCACCATCaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Sof.40 translated coding region predicted by ESTScan from UniGene Sof.40

XAFKNTALCPQELEDVAASIVERCKGLPLALISMGSLMSSKKPTKHAWNQMYNQFRVELAKPDNVQAILKLSYNDLPGDLRNCFLYCSLFPEDCIMSRESLVRQWVAEGFAVTKENNTLEDVAELNLVELITRNLLQVEEYDELGRVNTCKMHDIVRDLALSIARDEKFGSASDQAAVINMDREVRRLSLCQWNDSDAPRVKFPHLRTLFSLDGVTSAHMLASIFSESSYLTVLELQDSEITEVPQSIGNLFNLRYIGLRRTGVKSLPECIEKLSNLQTLDIKQTKIEKLPRGIVKVKKLRHLLADRVVDEKQKDFGYFTGVQPPKDLSNLVELQTLETVEATNDLAGQLDNLRKLKSVWVCKVTAIHSADLFPAVSKLPLLACLLLNASDEEQTLHLETLNPQSKQFHRLIVRGRWAAGTLQCPIFRGHGKNLKYLALSWSGLQEDPLLLIAPHVPNLTYLSLNRVSSTETMVISEGSFPQLKTLILKNMLNVNQLTVGKDALPNIEGLYIVALPKLNKVPEGFESLVSLRKLWLLSLHKDFKILWELSRMRQKMPHVVEVRVE

Domains

Domain Start-End Description Sequence

HMMPfam: PF00931
IPR002182
2-112 NB-ARC,NBS
NB-ARC

AFKNTALCPQELEDVAASIVERCKGLPLALISMGSLMSSKKPTKHAWNQMYNQFRVELAKPDNVQAILKLSYNDLPGDLRNCFLYCSLFPEDCIMSRESLVRQWVAEGFAV

HMMPanther: PTHR23155:SF199
47-559 OS11G0229500 PROTEIN,OS11G0229500 PROTEIN

AWNQMYNQFRVELAKPDNVQAILKLSYNDLPGDLRNCFLYCSLFPEDCIMSRESLVRQWVAEGFAVTKENNTLEDVAELNLVELITRNLLQVEEYDELGRVNTCKMHDIVRDLALSIARDEKFGSASDQAAVINMDREVRRLSLCQWNDSDAPRVKFPHLRTLFSLDGVTSAHMLASIFSESSYLTVLELQDSEITEVPQSIGNLFNLRYIGLRRTGVKSLPECIEKLSNLQTLDIKQTKIEKLPRGIVKVKKLRHLLADRVVDEKQKDFGYFTGVQPPKDLSNLVELQTLETVEATNDLAGQLDNLRKLKSVWVCKVTAIHSADLFPAVSKLPLLACLLLNASDEEQTLHLETLNPQSKQFHRLIVRGRWAAGTLQCPIFRGHGKNLKYLALSWSGLQEDPLLLIAPHVPNLTYLSLNRVSSTETMVISEGSFPQLKTLILKNMLNVNQLTVGKDALPNIEGLYIVALPKLNKVPEGFESLVSLRKLWLLSLHKDFKILWELSRMRQKMPHV

HMMPanther: PTHR23155
47-559 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

AWNQMYNQFRVELAKPDNVQAILKLSYNDLPGDLRNCFLYCSLFPEDCIMSRESLVRQWVAEGFAVTKENNTLEDVAELNLVELITRNLLQVEEYDELGRVNTCKMHDIVRDLALSIARDEKFGSASDQAAVINMDREVRRLSLCQWNDSDAPRVKFPHLRTLFSLDGVTSAHMLASIFSESSYLTVLELQDSEITEVPQSIGNLFNLRYIGLRRTGVKSLPECIEKLSNLQTLDIKQTKIEKLPRGIVKVKKLRHLLADRVVDEKQKDFGYFTGVQPPKDLSNLVELQTLETVEATNDLAGQLDNLRKLKSVWVCKVTAIHSADLFPAVSKLPLLACLLLNASDEEQTLHLETLNPQSKQFHRLIVRGRWAAGTLQCPIFRGHGKNLKYLALSWSGLQEDPLLLIAPHVPNLTYLSLNRVSSTETMVISEGSFPQLKTLILKNMLNVNQLTVGKDALPNIEGLYIVALPKLNKVPEGFESLVSLRKLWLLSLHKDFKILWELSRMRQKMPHV

superfamily: SSF52058
151-554 L domain-like,LRR

KMHDIVRDLALSIARDEKFGSASDQAAVINMDREVRRLSLCQWNDSDAPRVKFPHLRTLFSLDGVTSAHMLASIFSESSYLTVLELQDSEITEVPQSIGNLFNLRYIGLRRTGVKSLPECIEKLSNLQTLDIKQTKIEKLPRGIVKVKKLRHLLADRVVDEKQKDFGYFTGVQPPKDLSNLVELQTLETVEATNDLAGQLDNLRKLKSVWVCKVTAIHSADLFPAVSKLPLLACLLLNASDEEQTLHLETLNPQSKQFHRLIVRGRWAAGTLQCPIFRGHGKNLKYLALSWSGLQEDPLLLIAPHVPNLTYLSLNRVSSTETMVISEGSFPQLKTLILKNMLNVNQLTVGKDALPNIEGLYIVALPKLNKVPEGFESLVSLRKLWLLSLHKDFKILWELSRMRQ

Gene3D: G3DSA:3.80.10.10
220-342 no description

MLASIFSESSYLTVLELQDSEITEVPQSIGNLFNLRYIGLRRTGVKSLPECIEKLSNLQTLDIKQTKIEKLPRGIVKVKKLRHLLADRVVDEKQKDFGYFTGVQPPKDLSNLVELQTLETVEA

Gene3D: G3DSA:3.80.10.10
343-536 no description

TNDLAGQLDNLRKLKSVWVCKVTAIHSADLFPAVSKLPLLACLLLNASDEEQTLHLETLNPQSKQFHRLIVRGRWAAGTLQCPIFRGHGKNLKYLALSWSGLQEDPLLLIAPHVPNLTYLSLNRVSSTETMVISEGSFPQLKTLILKNMLNVNQLTVGKDALPNIEGLYIVALPKLNKVPEGFESLVSLRKLWL

Seg: seg
379-387 seg

LPLLACLLL

Seg: seg
527-539 seg

SLVSLRKLWLLSL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox