PRGDB00076892 (Sof.193)

From PRG Wiki
Jump to: navigation, search
Sof.193
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 35049668 (CA148534)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Saccharum officinarum

Comment?

SCJLRZ1018B08.g RZ1 Saccharum officinarum cDNA clone SCJLRZ1018B08 5', mRNA sequence

DNA Sequence

GATTTGCACATACTGTATTTCCAAAATTTTCTAGGTCATCTGGCATAGGTCACATAATTTTAGCTGGTGCTGGTCGCTGTAGTTCACCTTCAGGTCCATCAGGTTCACTGGGCTCAAGCATCGCAACATATGCAGGGCAGGCAAAAACATTCAAATTTGCTGAGATTGACAAGGCCACAAATGGCTTTGATGATTCAAAAGTACTTGGAGAAGGTGGCTTCGGATGTGTCTACCAGGGCACACTTGATGATGGAACAACGGTTGCAGTGAAGGTTCTGAAGAGATATGATGGCCAAGGTGAACGAGAATTCTTGGCCGAGGTTGAGATGCTGGGACGTTTGCATCACCGGAATTTGGTCAAGTTGTTAGGCATCTGCATCGAGGAGAATGCACGGTGTCTGGTATACGAGCTTATTCCAAATGGCAGCGTAGAATCCCATCTGCATGGAGCGGACCGTGAGACAGCTCCACTTGATTGGAATTCCCCGATGAAGATAGCCCTTGGGGCAGCACGAGCACTTGCATATCTACATGAAGATTCTTAGCCTTGTGTGATTCATTCCGAATTTAAGTCAAGCAACATTCTTCTGGAGCATGATTCCACACCAAAAGTGGTCAGACTTTGGACTTGCCATACTCTCAAGGGGAAGAGGGCATCCATCACATCTCTTCCCGTGCAAGGGGTCAATTCGGCTTTGTGTGTCCGGAATAACCTCAGAACGGTTCACTTCTTGGTAAAAGTAATGACTCGCGTTATTGGATTGTATTAACTACGACTACCTAACTTGTGGTAACAACGGGTCATATAATCTTATTCACCGGACAATAAATCCCTTCGTCTTGTTCTACTTCCTTTATAAACATGTACTGTCCCGTCTGACTGCTATCGATCCAACGTAACCGAATGGA


Protein sequences

Name Description Sequence
Sof.193 translated coding region predicted by ESTScan from UniGene Sof.193

XFAHTVFPKFSRSSGIGHIILAGAGRCSSPSGPSGSLGSSIATYAGQAKTFKFAEIDKATNGFDDSKVLGEGGFGCVYQGTLDDGTTVAVKVLKRYDGQGEREFLAEVEMLGRLHHRNLVKLLGICIEENARCLVYELIPNGSVESHLHGADRETAPLDWNSPMKIALGAARALAYLHEDSXPCVIHSEFKSSNILLEHDSTPKVVRLWTCHTLKGKRASITSLPVQGVNSALCVRNNLRTVHFLVKVMTRVIGLY

Domains

Domain Start-End Description Sequence

Seg: seg
28-40 seg

SSPSGPSGSLGSS

HMMPanther: PTHR24420:SF801
29-205 SUBFAMILY NOT NAMED

SPSGPSGSLGSSIATYAGQAKTFKFAEIDKATNGFDDSKVLGEGGFGCVYQGTLDDGTTVAVKVLKRYDGQGEREFLAEVEMLGRLHHRNLVKLLGICIEENARCLVYELIPNGSVESHLHGADRETAPLDWNSPMKIALGAARALAYLHEDSXPCVIHSEFKSSNILLEHDSTPKV

HMMPanther: PTHR24420
29-205 FAMILY NOT NAMED,FAMILY NOT NAMED

SPSGPSGSLGSSIATYAGQAKTFKFAEIDKATNGFDDSKVLGEGGFGCVYQGTLDDGTTVAVKVLKRYDGQGEREFLAEVEMLGRLHHRNLVKLLGICIEENARCLVYELIPNGSVESHLHGADRETAPLDWNSPMKIALGAARALAYLHEDSXPCVIHSEFKSSNILLEHDSTPKV

superfamily: SSF56112
IPR011009
35-205 Protein kinase-like (PK-like)
Protein kinase-like domain

GSLGSSIATYAGQAKTFKFAEIDKATNGFDDSKVLGEGGFGCVYQGTLDDGTTVAVKVLKRYDGQGEREFLAEVEMLGRLHHRNLVKLLGICIEENARCLVYELIPNGSVESHLHGADRETAPLDWNSPMKIALGAARALAYLHEDSXPCVIHSEFKSSNILLEHDSTPKV

Gene3D: G3DSA:3.30.200.20
44-124 no description

YAGQAKTFKFAEIDKATNGFDDSKVLGEGGFGCVYQGTLDDGTTVAVKVLKRYDGQGEREFLAEVEMLGRLHHRNLVKLLG

ProfileScan: PS50011
IPR000719
63-256 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FDDSKVLGEGGFGCVYQGTLDDGTTVAVKVLKRYDGQGEREFLAEVEMLGRLHHRNLVKLLGICIEENARCLVYELIPNGSVESHLHGADRETAPLDWNSPMKIALGAARALAYLHEDSXPCVIHSEFKSSNILLEHDSTPKVVRLWTCHTLKGKRASITSLPVQGVNSALCVRNNLRTVHFLVKVMTRVIGLY

HMMSmart: SM00219
IPR020635
63-256 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FDDSKVLGEGGFGCVYQGTLDDGTTVAVKVLKRYDGQGEREFLAEVEMLGRLHHRNLVKLLGICIEENARCLVYELIPNGSVESHLHGADRETAPLDWNSPMKIALGAARALAYLHEDSXPCVIHSEFKSSNILLEHDSTPKVVRLWTCHTLKGKRASITSLPVQGVNSALCVRNNLRTVHFLVKVMTRVIGLY

HMMSmart: SM00220
IPR002290
63-245 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FDDSKVLGEGGFGCVYQGTLDDGTTVAVKVLKRYDGQGEREFLAEVEMLGRLHHRNLVKLLGICIEENARCLVYELIPNGSVESHLHGADRETAPLDWNSPMKIALGAARALAYLHEDSXPCVIHSEFKSSNILLEHDSTPKVVRLWTCHTLKGKRASITSLPVQGVNSALCVRNNLRTVHFL

HMMPfam: PF07714
IPR001245
66-205 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

SKVLGEGGFGCVYQGTLDDGTTVAVKVLKRYDGQGEREFLAEVEMLGRLHHRNLVKLLGICIEENARCLVYELIPNGSVESHLHGADRETAPLDWNSPMKIALGAARALAYLHEDSXPCVIHSEFKSSNILLEHDSTPKV

PatternScan: PS00107
IPR017441
69-91 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGGFGCVYQGTLDDGTTVAVK

Gene3D: G3DSA:1.10.510.10
125-214 no description

ICIEENARCLVYELIPNGSVESHLHGADRETAPLDWNSPMKIALGAARALAYLHEDSXPCVIHSEFKSSNILLEHDSTPKVVRLWTCHTL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox