PRGDB00077118 (Sof.23323)

From PRG Wiki
Jump to: navigation, search
Sof.23323
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 268780898 (DN194074)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Saccharum officinarum

Comment?

SUM01-032F-A06-037.b Sugarcane mature leaf tissue library Saccharum officinarum cDNA clone SUM01-032F-A06-037 5', mRNA sequence

DNA Sequence

TTCTGCAAGTCTGCTTCTGTCGTAGGCAGCGCGCTCTCTCCCTGAGCAGGAATGGAGTCATCAAGTCCTCTATTATCTTTTCCAAGTCTTCTACCATTTGATTTTATAAAGGGCGTCACTGAAGACTTCGCTGAGGAGCGAAAAATTGGTCAAGGTGGATTCGGAGTGGTCTACAAGGGAGTACTTGCTAATGGGGGTGTGATTGCTGTGAAGAGGTTTCGAGATGTATCAACGATTTATGACAAACAGTTTGAAAATGAGGTGGGCAGTCTTCTGCAGATCAGTCACAAAAATATCGTTAAATTACTTGGCTACTGTTATGAAAGTAGAAAAAAGGTGGTGGAGCACAGAGGAAGATACATCATCGCAGAAGAAGTAGAAAAGCTGCTTTGCTATGAATATATGCCCAAGGGAAGCCTTGACAAGCATCTTTTTGATGAACGTTGTCGACTTGACTGGCATATGCGCTACAAAATAATTAGGGGGATTTGTGATGGTTTACATTTCCTACACGAGGGACTTGAACGTCCCATTATTCACATGGATCTGAAACCTGAAAATATATTGCTGGATGATAACATGGTGCCAAAAATTGCAGATTTTGGTTTCTCAAGGCTCTTTGGTCAAGAACAAACCCGAACCTGTACCCAAAATGTCATTGGGTCAATAGGTTACATGGCTCCAGA


Protein sequences

Name Description Sequence
Sof.23323 translated coding region predicted by ESTScan from UniGene Sof.23323

FCKSASVVGSALSPXAGMESSSPLLSFPSLLPFDFIKGVTEDFAEERKIGQGGFGVVYKGVLANGGVIAVKRFRDVSTIYDKQFENEVGSLLQISHKNIVKLLGYCYESRKKVVEHRGRYIIAEEVEKLLCYEYMPKGSLDKHLFDERCRLDWHMRYKIIRGICDGLHFLHEGLERPIIHMDLKPENILLDDNMVPKIADFGFSRLFGQEQTRTCTQNVIGSIGYMAPX

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
13-228 Protein kinase-like (PK-like)
Protein kinase-like domain

SPXAGMESSSPLLSFPSLLPFDFIKGVTEDFAEERKIGQGGFGVVYKGVLANGGVIAVKRFRDVSTIYDKQFENEVGSLLQISHKNIVKLLGYCYESRKKVVEHRGRYIIAEEVEKLLCYEYMPKGSLDKHLFDERCRLDWHMRYKIIRGICDGLHFLHEGLERPIIHMDLKPENILLDDNMVPKIADFGFSRLFGQEQTRTCTQNVIGSIGYMAP

Seg: seg
20-33 seg

SSSPLLSFPSLLPF

Gene3D: G3DSA:3.30.200.20
37-102 no description

KGVTEDFAEERKIGQGGFGVVYKGVLANGGVIAVKRFRDVSTIYDKQFENEVGSLLQISHKNIVKL

HMMPanther: PTHR24420
40-228 FAMILY NOT NAMED,FAMILY NOT NAMED

TEDFAEERKIGQGGFGVVYKGVLANGGVIAVKRFRDVSTIYDKQFENEVGSLLQISHKNIVKLLGYCYESRKKVVEHRGRYIIAEEVEKLLCYEYMPKGSLDKHLFDERCRLDWHMRYKIIRGICDGLHFLHEGLERPIIHMDLKPENILLDDNMVPKIADFGFSRLFGQEQTRTCTQNVIGSIGYMAP

ProfileScan: PS50011
IPR000719
43-229 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FAEERKIGQGGFGVVYKGVLANGGVIAVKRFRDVSTIYDKQFENEVGSLLQISHKNIVKLLGYCYESRKKVVEHRGRYIIAEEVEKLLCYEYMPKGSLDKHLFDERCRLDWHMRYKIIRGICDGLHFLHEGLERPIIHMDLKPENILLDDNMVPKIADFGFSRLFGQEQTRTCTQNVIGSIGYMAPX

HMMSmart: SM00220
IPR002290
43-229 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FAEERKIGQGGFGVVYKGVLANGGVIAVKRFRDVSTIYDKQFENEVGSLLQISHKNIVKLLGYCYESRKKVVEHRGRYIIAEEVEKLLCYEYMPKGSLDKHLFDERCRLDWHMRYKIIRGICDGLHFLHEGLERPIIHMDLKPENILLDDNMVPKIADFGFSRLFGQEQTRTCTQNVIGSIGYMAPX

HMMSmart: SM00219
IPR020635
43-223 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FAEERKIGQGGFGVVYKGVLANGGVIAVKRFRDVSTIYDKQFENEVGSLLQISHKNIVKLLGYCYESRKKVVEHRGRYIIAEEVEKLLCYEYMPKGSLDKHLFDERCRLDWHMRYKIIRGICDGLHFLHEGLERPIIHMDLKPENILLDDNMVPKIADFGFSRLFGQEQTRTCTQNVIGSI

HMMPfam: PF00069
IPR017442
45-228 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

EERKIGQGGFGVVYKGVLANGGVIAVKRFRDVSTIYDKQFENEVGSLLQISHKNIVKLLGYCYESRKKVVEHRGRYIIAEEVEKLLCYEYMPKGSLDKHLFDERCRLDWHMRYKIIRGICDGLHFLHEGLERPIIHMDLKPENILLDDNMVPKIADFGFSRLFGQEQTRTCTQNVIGSIGYMAP

PatternScan: PS00107
IPR017441
49-71 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGQGGFGVVYKGVLANGGVIAVK

Gene3D: G3DSA:1.10.510.10
103-228 no description

LGYCYESRKKVVEHRGRYIIAEEVEKLLCYEYMPKGSLDKHLFDERCRLDWHMRYKIIRGICDGLHFLHEGLERPIIHMDLKPENILLDDNMVPKIADFGFSRLFGQEQTRTCTQNVIGSIGYMAP

PatternScan: PS00108
IPR008271
178-190 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHMDLKPENILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox