PRGDB00077124 (Sof.23492)

From PRG Wiki
Jump to: navigation, search
Sof.23492
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 268780696 (DN193963)
Gene Class Unknown
Domain Type
Gene Species Saccharum officinarum

Comment?

SUM01-019F-C07-052.b Sugarcane mature leaf tissue library Saccharum officinarum cDNA clone SUM01-019F-C07-052 5', mRNA sequence

DNA Sequence

ATCACCAAAATTGTGTTGATATGATGTACCTTCTTGCTCTTTCTTCTCTAGAATATTCCTGTTGATGCTTATAAGAGAAGGTTGGTTTGGATCGGAGCTCAGCATCACTTGCCACTGTCTGAGAATATGGTGTGCTCAAACAAGGGCAAAGTATGTGTAACTGGGGCTTCAGGCTTTGTTGCCTCTTGGCTTATCAAACGGCTTCTCGAGTCTGGATATCATGTGGTAGGGACTGTCAGAGACCCAGGAAATCACCAAAAGACGGCACACCTTTGGAAGTTACCTGGTGCCAAAGAGAGGCTGCAAATTGTGCGAGCTGATCTGTTGGAAGAAGGAAGCTTTGACAAGGCCGTGATGAACTGTGATGGCGTCTTCCACACTGCATCCCCTGTCCTCGCTAAATCTGATTCTAGTAGCAAGGAGGAAACGCTCGTTCCAGCAGTAAATGGTACTCTGAATGTGCTAAGATCGTGCAAGAAGAACCCATTTCTGAAAAGGGTTGTTCTTACATCTTCATCATGTGCAGTGAGGATTAGGGATGATGATCAGCCTAATATCTCACTGGATGAAACAACATGGAGCTCTGTGCCACTCTGTGAAAAGATGCAGCTATGGTATGCCCT


Protein sequences

Name Description Sequence
Sof.23492 translated coding region predicted by ESTScan from UniGene Sof.23492

MVCSNKGKVCVTGASGFVASWLIKRLLESGYHVVGTVRDPGNHQKTAHLWKLPGAKERLQIVRADLLEEGSFDKAVMNCDGVFHTASPVLAKSDSSSKEETLVPAVNGTLNVLRSCKKNPFLKRVVLTSSSCAVRIRDDDQPNISLDETTWSSVPLCEKMQLWYAL

Domains

Domain Start-End Description Sequence

superfamily: SSF51735
1-164 NAD(P)-binding Rossmann-fold domains

MVCSNKGKVCVTGASGFVASWLIKRLLESGYHVVGTVRDPGNHQKTAHLWKLPGAKERLQIVRADLLEEGSFDKAVMNCDGVFHTASPVLAKSDSSSKEETLVPAVNGTLNVLRSCKKNPFLKRVVLTSSSCAVRIRDDDQPNISLDETTWSSVPLCEKMQLWY

HMMPanther: PTHR10366:SF9
5-166 CINNAMOYL-COA REDUCTASE,CINNAMOYL-COA REDUCTASE

NKGKVCVTGASGFVASWLIKRLLESGYHVVGTVRDPGNHQKTAHLWKLPGAKERLQIVRADLLEEGSFDKAVMNCDGVFHTASPVLAKSDSSSKEETLVPAVNGTLNVLRSCKKNPFLKRVVLTSSSCAVRIRDDDQPNISLDETTWSSVPLCEKMQLWYAL

HMMPanther: PTHR10366
5-166 FAMILY NOT NAMED,NAD DEPENDENT EPIMERASE/DEHYDRATASE

NKGKVCVTGASGFVASWLIKRLLESGYHVVGTVRDPGNHQKTAHLWKLPGAKERLQIVRADLLEEGSFDKAVMNCDGVFHTASPVLAKSDSSSKEETLVPAVNGTLNVLRSCKKNPFLKRVVLTSSSCAVRIRDDDQPNISLDETTWSSVPLCEKMQLWYAL

Gene3D: G3DSA:3.40.50.720
IPR016040
8-153 no description
NAD(P)-binding domain

KVCVTGASGFVASWLIKRLLESGYHVVGTVRDPGNHQKTAHLWKLPGAKERLQIVRADLLEEGSFDKAVMNCDGVFHTASPVLAKSDSSSKEETLVPAVNGTLNVLRSCKKNPFLKRVVLTSSSCAVRIRDDDQPNISLDETTWSS

HMMPfam: PF01370
IPR001509
9-142 Epimerase
NAD-dependent epimerase/dehydratase

VCVTGASGFVASWLIKRLLESGYHVVGTVRDPGNHQKTAHLWKLPGAKERLQIVRADLLEEGSFDKAVMNCDGVFHTASPVLAKSDSSSKEETLVPAVNGTLNVLRSCKKNPFLKRVVLTSSSCAVRIRDDDQP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox