PRGDB00077154 (Stu.1900)

From PRG Wiki
Jump to: navigation, search
Stu.1900
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 21375822 (BQ516953)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Solanum tuberosum

Comment?

EST624368 Generation of a set of potato cDNA clones for microarray analyses mixed potato tissues Solanum tuberosum cDNA clone STMJA76 3' end, mRNA sequence

DNA Sequence

TTTACTTAACGAACATGGAACCCGCTTTTATTACTTAACTTCAGTATATAGTATACTGCAATTTGTATATATTCTAGTACAAAGGCTCTGAAACCTTCAGATTGAAATAAGTAATCTATATAAGCAACTCAACAATACAGAAAGGCTAATCTTAATAATATTTTGCTGTGAAAGTTCTGATCAACATACTTGTTACTTCACAACCACTTGGTGCTGAGCATAATCTTTTCCATACCAGGGCACCTTACATTTCAAGGAATCTCACTTTCATGGAATCTGATGATTGGGTGGATCCATTGATAACATATGAGAGATGAAGTGCATCATTGGCCTTGATTTTGGATTTTCAACCAAACATGAGATTGCTAGCTTGACGATGAAAACCAAAAACTCTTTTACTTCATCCTCAGGATGTGGAAGGCGTTCATCTAGCAAATCGCTTAGCTGCACATCTCTTGTTGATGGATTTGCTAGAAGAGTAAGGTATTCCCCAAGATGCTTTCCTTTGATTACCTCCAATGCTAATACTCCAAAGCTGTAGACGTCACACATTTCCGTCACCTTCAATGTATAGGCAAGCTCTGGTGCTACATAGCCATATGTGCCTGCAAGTGCAGTACAATTGGATGAGTCTGGCTTGAGAATCTTAGCTATGCCAAAATCAGAAACACGAGCTTCAAACTCGGAGTCAAGCAAAACATTACTGGCTTGATATGTCCCGATGAACAATCGGGGGGTGAGCAATCGTGGTGCATGTAGA


Protein sequences

Name Description Sequence
Stu.1900 translated coding region predicted by ESTScan from UniGene Stu.1900

XLHAPRLLTPRLFIGTYQASNVLLDSEFEARVSDFGIAKILKPDSSNCTALAGTYGYVAPELAYTLKVTEMCDVYSFGVLALEVIKGKHLGEYLTLLANPSTRDVQLSDLLDERLPHPEDEVKEFLVFIVKLAISCLVENPKSRPMMHFISHMLSMDPPNHQIP

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-155 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XLHAPRLLTPRLFIGTYQASNVLLDSEFEARVSDFGIAKILKPDSSNCTALAGTYGYVAPELAYTLKVTEMCDVYSFGVLALEVIKGKHLGEYLTLLANPSTRDVQLSDLLDERLPHPEDEVKEFLVFIVKLAISCLVENPKSRPMMHFISHMLS

Gene3D: G3DSA:1.10.510.10
19-155 no description

ASNVLLDSEFEARVSDFGIAKILKPDSSNCTALAGTYGYVAPELAYTLKVTEMCDVYSFGVLALEVIKGKHLGEYLTLLANPSTRDVQLSDLLDERLPHPEDEVKEFLVFIVKLAISCLVENPKSRPMMHFISHMLS

superfamily: SSF56112
IPR011009
19-154 Protein kinase-like (PK-like)
Protein kinase-like domain

ASNVLLDSEFEARVSDFGIAKILKPDSSNCTALAGTYGYVAPELAYTLKVTEMCDVYSFGVLALEVIKGKHLGEYLTLLANPSTRDVQLSDLLDERLPHPEDEVKEFLVFIVKLAISCLVENPKSRPMMHFISHML

HMMPfam: PF00069
IPR017442
20-149 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

SNVLLDSEFEARVSDFGIAKILKPDSSNCTALAGTYGYVAPELAYTLKVTEMCDVYSFGVLALEVIKGKHLGEYLTLLANPSTRDVQLSDLLDERLPHPEDEVKEFLVFIVKLAISCLVENPKSRPMMHF

HMMPanther: PTHR24420:SF472
21-157 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

NVLLDSEFEARVSDFGIAKILKPDSSNCTALAGTYGYVAPELAYTLKVTEMCDVYSFGVLALEVIKGKHLGEYLTLLANPSTRDVQLSDLLDERLPHPEDEVKEFLVFIVKLAISCLVENPKSRPMMHFISHMLSMD

HMMPanther: PTHR24420
21-157 FAMILY NOT NAMED,FAMILY NOT NAMED

NVLLDSEFEARVSDFGIAKILKPDSSNCTALAGTYGYVAPELAYTLKVTEMCDVYSFGVLALEVIKGKHLGEYLTLLANPSTRDVQLSDLLDERLPHPEDEVKEFLVFIVKLAISCLVENPKSRPMMHFISHMLSMD






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox