PRGDB00077157 (Stu.2254)

From PRG Wiki
Jump to: navigation, search
Stu.2254
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 10445548 (BE919388)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Solanum tuberosum

Comment?

EST423241 potato leaves and petioles Solanum tuberosum cDNA clone cSTB1J5 5' sequence, mRNA sequence

DNA Sequence

CTTCGCCTCTCTCAAGTTGTAAAGGAGAAGAAAATGGGTTGGTTTCCTTGTTCTGGACCATCCAAACAGACCTCAAAGAAGAAAAATTCAGTCGATTCCGGCCGGCACTCTACTGATAAGTTGAAATCAAAGAATTCATTACGCTCAAAGGAAGTTGATAAGGATGCAGGGTCCAACCAAATTGCAGCCAAGACTTTTATATTTCGTGATTTAGCAGCTGCAACAAAAAATTTCCGAGGTGATTTTCTTCTTGGAGAAGGAGGCTTTGGTAGAGTTTACAAAGGGGTGATCGAGTCCAATCAGGTCGTCGCCATCAAGCAACTCGATCGTAATGGATTGCAAGGCAACAGGGAATTTCTTGTTGAAGTGCTGATGTTAAGTCTGTTACACCATCCTAACCTTGTAAATCTAATTGGCTATTGTGCTGATGGAGATCAGAGACTTCTGGTCTACGAATATATGCCATTAGGGTCATTGGAGGATCATCTTCATGAT


Protein sequences

Name Description Sequence
Stu.2254 translated coding region predicted by ESTScan from UniGene Stu.2254

LRLSQVVKEKKMGWFPCSGPSKQTSKKKNSVDSGRHSTDKLKSKNSLRSKEVDKDAGSNQIAAKTFIFRDLAAATKNFRGDFLLGEGGFGRVYKGVIESNQVVAIKQLDRNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHD

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF700
58-165 SUBFAMILY NOT NAMED

SNQIAAKTFIFRDLAAATKNFRGDFLLGEGGFGRVYKGVIESNQVVAIKQLDRNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHD

HMMPanther: PTHR24420
58-165 FAMILY NOT NAMED,FAMILY NOT NAMED

SNQIAAKTFIFRDLAAATKNFRGDFLLGEGGFGRVYKGVIESNQVVAIKQLDRNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHD

Gene3D: G3DSA:3.30.200.20
62-154 no description

AAKTFIFRDLAAATKNFRGDFLLGEGGFGRVYKGVIESNQVVAIKQLDRNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEYM

superfamily: SSF56112
IPR011009
64-165 Protein kinase-like (PK-like)
Protein kinase-like domain

KTFIFRDLAAATKNFRGDFLLGEGGFGRVYKGVIESNQVVAIKQLDRNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHD

ProfileScan: PS50011
IPR000719
78-165 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FRGDFLLGEGGFGRVYKGVIESNQVVAIKQLDRNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHD

HMMPfam: PF07714
IPR001245
84-164 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

LGEGGFGRVYKGVIESNQVVAIKQLDRNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEYMPLGSLEDHLH

PatternScan: PS00107
IPR017441
84-106 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGGFGRVYKGVIESNQVVAIK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox