PRGDB00077158 (Stu.2331)

From PRG Wiki
Jump to: navigation, search
Stu.2331
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 21926012 (BQ510315)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Solanum tuberosum

Comment?

EST617730 Generation of a set of potato cDNA clones for microarray analyses mixed potato tissues Solanum tuberosum cDNA clone STMHJ41 3' end, mRNA sequence

DNA Sequence

TCTTTGATGCATCAGCTTCCCTTCCACTTTCACTTTTGAGTGGGTTTGCTTGAGCTTCATACAATGTGACACTGCCACCTCCAGTCATAAGAAGTGCCTCTTCACCTTTATCTTGTGGCTGAAGGGCTTCAAGTATTTCAACAACGACACTCATGACAGGCCTTCCCTTTGGATTTTGACTTAGGCATTGATAGGCTAGATTAGCAACTTTCAAAGCAGTTTTAGAGGAGTATTGACCGTCCAGTCTGGGGTCAATTATCCTGAAAAGCTTCTTGCCATGATTCAAGAGAGGTCGAGCAAACTCAACAAGGTTATGTTCCCGGCTAGGTTTACTTTTGTCCATTGCTCTCCTTCCAATGAGCATTTCAAGCAAAACAACGCCAAAACCATAAACATCACTTCTGGCTGTTAAATGTCCGGTCATGACATACTCTGGAGCAGCATAGCCATAAGTGCCCATCACACGAGTTGATACATGTGTTTGATCTCCCATGGGCCCATCTTTTGCAAGTCCAAAGTCAGAAAGCTTTGCGTTAAATTCCGCATCCAACAAAATGTTTGACGTCTTGAAGTCTCTATATATTATAGGCCTTTCAGCTCCATGAAGAAAAGCAAGCCCTTTAGCAGCATCCAAAGCAATTCTCATTCTTCTTGACCCAGATAGAGTAGCACACACTCTTGGAAAAAGGTGCGTTTCCAGGCTGCCAGATGCCATATATTCATAAACCAGCAGTCTATGGTAATCCTCACAGCAATATCCTATCAGCTTCACCAGATTCGGATGTCGAATATGCCCCCAGTAATTCACCTCTGCCAGCCACTCTCTGTCGCCCTGAAGACTTTCTGGATCAAGCTCCTTAATGGCAACATATGTGGTCTTGTATCCTGGTCTGACATTTTCATCAATAACTCCTTTGTAGACAATGCCAAACCCACCCTCTCCGAGTACCTTATCTGGTCGAAAGTGCTTGGTAGACACTTCATCTCCTCATATGTGAAGATAT


Protein sequences

Name Description Sequence
Stu.2331 translated coding region predicted by ESTScan from UniGene Stu.2331

XYLHIXGDEVSTKHFRPDKVLGEGGFGIVYKGVIDENVRPGYKTTYVAIKELDPESLQGDREWLAEVNYWGHIRHPNLVKLIGYCCEDYHRLLVYEYMASGSLETHLFPRVCATLSGSRRMRIALDAAKGLAFLHGAERPIIYRDFKTSNILLDAEFNAKLSDFGLAKDGPMGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYGFGVVLLEMLIGRRAMDKSKPSREHNLVEFARPLLNHGKKLFRIIDPRLDGQYSSKTALKVANLAYQCLSQNPKGRPVMSVVVEILEALQPQDKGEEALLMTGGGSVTLYEAQANPLKSESGREADASKX

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
9-300 Protein kinase-like (PK-like)
Protein kinase-like domain

EVSTKHFRPDKVLGEGGFGIVYKGVIDENVRPGYKTTYVAIKELDPESLQGDREWLAEVNYWGHIRHPNLVKLIGYCCEDYHRLLVYEYMASGSLETHLFPRVCATLSGSRRMRIALDAAKGLAFLHGAERPIIYRDFKTSNILLDAEFNAKLSDFGLAKDGPMGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYGFGVVLLEMLIGRRAMDKSKPSREHNLVEFARPLLNHGKKLFRIIDPRLDGQYSSKTALKVANLAYQCLSQNPKGRPVMSVVVEILEALQPQDK

Gene3D: G3DSA:3.30.200.20
9-85 no description

EVSTKHFRPDKVLGEGGFGIVYKGVIDENVRPGYKTTYVAIKELDPESLQGDREWLAEVNYWGHIRHPNLVKLIGYC

HMMPanther: PTHR24420:SF529
10-296 SUBFAMILY NOT NAMED

VSTKHFRPDKVLGEGGFGIVYKGVIDENVRPGYKTTYVAIKELDPESLQGDREWLAEVNYWGHIRHPNLVKLIGYCCEDYHRLLVYEYMASGSLETHLFPRVCATLSGSRRMRIALDAAKGLAFLHGAERPIIYRDFKTSNILLDAEFNAKLSDFGLAKDGPMGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYGFGVVLLEMLIGRRAMDKSKPSREHNLVEFARPLLNHGKKLFRIIDPRLDGQYSSKTALKVANLAYQCLSQNPKGRPVMSVVVEILEALQ

HMMPanther: PTHR24420
10-296 FAMILY NOT NAMED,FAMILY NOT NAMED

VSTKHFRPDKVLGEGGFGIVYKGVIDENVRPGYKTTYVAIKELDPESLQGDREWLAEVNYWGHIRHPNLVKLIGYCCEDYHRLLVYEYMASGSLETHLFPRVCATLSGSRRMRIALDAAKGLAFLHGAERPIIYRDFKTSNILLDAEFNAKLSDFGLAKDGPMGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYGFGVVLLEMLIGRRAMDKSKPSREHNLVEFARPLLNHGKKLFRIIDPRLDGQYSSKTALKVANLAYQCLSQNPKGRPVMSVVVEILEALQ

ProfileScan: PS50011
IPR000719
15-295 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FRPDKVLGEGGFGIVYKGVIDENVRPGYKTTYVAIKELDPESLQGDREWLAEVNYWGHIRHPNLVKLIGYCCEDYHRLLVYEYMASGSLETHLFPRVCATLSGSRRMRIALDAAKGLAFLHGAERPIIYRDFKTSNILLDAEFNAKLSDFGLAKDGPMGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYGFGVVLLEMLIGRRAMDKSKPSREHNLVEFARPLLNHGKKLFRIIDPRLDGQYSSKTALKVANLAYQCLSQNPKGRPVMSVVVEILEAL

HMMSmart: SM00219
IPR020635
15-292 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FRPDKVLGEGGFGIVYKGVIDENVRPGYKTTYVAIKELDPESLQGDREWLAEVNYWGHIRHPNLVKLIGYCCEDYHRLLVYEYMASGSLETHLFPRVCATLSGSRRMRIALDAAKGLAFLHGAERPIIYRDFKTSNILLDAEFNAKLSDFGLAKDGPMGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYGFGVVLLEMLIGRRAMDKSKPSREHNLVEFARPLLNHGKKLFRIIDPRLDGQYSSKTALKVANLAYQCLSQNPKGRPVMSVVVEIL

HMMSmart: SM00220
IPR002290
15-295 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FRPDKVLGEGGFGIVYKGVIDENVRPGYKTTYVAIKELDPESLQGDREWLAEVNYWGHIRHPNLVKLIGYCCEDYHRLLVYEYMASGSLETHLFPRVCATLSGSRRMRIALDAAKGLAFLHGAERPIIYRDFKTSNILLDAEFNAKLSDFGLAKDGPMGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYGFGVVLLEMLIGRRAMDKSKPSREHNLVEFARPLLNHGKKLFRIIDPRLDGQYSSKTALKVANLAYQCLSQNPKGRPVMSVVVEILEAL

HMMPfam: PF07714
IPR001245
18-292 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

DKVLGEGGFGIVYKGVIDENVRPGYKTTYVAIKELDPESLQGDREWLAEVNYWGHIRHPNLVKLIGYCCEDYHRLLVYEYMASGSLETHLFPRVCATLSGSRRMRIALDAAKGLAFLHGAERPIIYRDFKTSNILLDAEFNAKLSDFGLAKDGPMGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYGFGVVLLEMLIGRRAMDKSKPSREHNLVEFARPLLNHGKKLFRIIDPRLDGQYSSKTALKVANLAYQCLSQNPKGRPVMSVVVEIL

PatternScan: PS00107
IPR017441
21-50 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGGFGIVYKGVIDENVRPGYKTTYVAIK

Gene3D: G3DSA:1.10.510.10
86-295 no description

CEDYHRLLVYEYMASGSLETHLFPRVCATLSGSRRMRIALDAAKGLAFLHGAERPIIYRDFKTSNILLDAEFNAKLSDFGLAKDGPMGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYGFGVVLLEMLIGRRAMDKSKPSREHNLVEFARPLLNHGKKLFRIIDPRLDGQYSSKTALKVANLAYQCLSQNPKGRPVMSVVVEILEAL

PatternScan: PS00108
IPR008271
141-153 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIYRDFKTSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox