PRGDB00077159 (Stu.2368)

From PRG Wiki
Jump to: navigation, search
Stu.2368
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 53780851 (CV498494)
Gene Class Unknown
Domain Type
Gene Species Solanum tuberosum

Comment?

62773.1 Mixed Leaf Solanum tuberosum cDNA clone 62773 5', mRNA sequence

DNA Sequence

GAAAACTTGATTGTCATCATTTGCAACTCTAGCATTGTGTGTGATAAACAGTGCTAGAAATTTGCAATTCTTTGGCTAGAAAAACAAAAGgagagagagagaTGGCAGTTGATTTTGGTCACTACGCTTTTGCTTTTGGTGTCCTTGGTAACATTGTCTCGTTCATTGTGTTCCTTTCTCCAATACCCACGTTCTATAACATTTACAAGAAGAAATCAACAGAAGGGTATCAATCAATTCCATACGTGGTTGCTCTTTTTAGTTCTATGCTTTGGATATATTATGCACTTTTGAAATCCAACATGCCCCTACTCATTACAATTAACTCCTTTGGTATGTTCATTGAGACCATCTACGTTGGTTTCTACCTTTTCTACGCACCAAAGAAAGCCAGGGTCCATACTATAAAAATGCTCATGTTATCTGTAGTTGGTGGATTTGGTGCAATAGTCCTAGTTACTGAATTTCTATTCAAAGGAGTCGTTCGTGGACAAATTGTTGGATGGATTTGCCTTATTTTCTCCTTGTGTGTATTTGTTGCACCCTTAGGCATTGTGAGGCAAGTCATCAAGACCAAGAGTGTGGAATACCATGGCACTTCTCCTATCAGTTTTTCTCACATTAAGTTGCGGATATGTGGTCCTTCCTATGGGTCTTTCTACTAAGAGGGACTATTACCATTGTTGTCCAAATGTATTGGGGATTCATCTTTGGAATACTCCGAATTTATAACTCCTAATGCACCTAATTACAGGCACAACACGGGAGAAGGTCCCATTCATTAAAGGGAGCAGAAAACTTTCCAGAATTTGCAAAAGGCTGAAAGTCCCTTGGCAACGGATGAGAACCTGAATTGCCATTAGAAGGTTCCG


Protein sequences

Name Description Sequence
Stu.2368 translated coding region predicted by ESTScan from UniGene Stu.2368

MAVDFGHYAFAFGVLGNIVSFIVFLSPIPTFYNIYKKKSTEGYQSIPYVVALFSSMLWIYYALLKSNMPLLITINSFGMFIETIYVGFYLFYAPKKARVHTIKMLMLSVVGGFGAIVLVTEFLFKGVVRGQIVGWICLIFSLCVFVAPLGIVRQVIKTKSVEYHGTSPISFSHIKLRICGPSYGSFYXEGLLPLLSKCIGDSSLEYSEFITPNAPNYRHNTGEGPIHXREQKTFQNLQKAESPLATDENLNCHXKVP


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10791
IPR004316
8-163 RAG1-ACTIVATING PROTEIN 1
RAG1-activating protein-1-related

YAFAFGVLGNIVSFIVFLSPIPTFYNIYKKKSTEGYQSIPYVVALFSSMLWIYYALLKSNMPLLITINSFGMFIETIYVGFYLFYAPKKARVHTIKMLMLSVVGGFGAIVLVTEFLFKGVVRGQIVGWICLIFSLCVFVAPLGIVRQVIKTKSVEY

HMMPfam: PF03083
IPR004316
11-97 MtN3_slv
RAG1-activating protein-1-related

AFGVLGNIVSFIVFLSPIPTFYNIYKKKSTEGYQSIPYVVALFSSMLWIYYALLKSNMPLLITINSFGMFIETIYVGFYLFYAPKKA

HMMPfam: PF03083
IPR004316
131-169 MtN3_slv
RAG1-activating protein-1-related

QIVGWICLIFSLCVFVAPLGIVRQVIKTKSVEYHGTSPI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox