PRGDB00077160 (Stu.2493)

From PRG Wiki
Jump to: navigation, search
Stu.2493
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 39835043 (CK278065)
Gene Class Unknown
Domain Type
Gene Species Solanum tuberosum

Comment?

EST724143 potato abiotic stress cDNA library Solanum tuberosum cDNA clone POAE374 5' end, mRNA sequence

DNA Sequence

CTCTTCTCTGAGCCTGTTTTACTTATTAACTGCATTTCAGGAATAAGGCGAATTTGTGAAGGGGGAGAAAATGGACTATGTTAATGGACCTGGAAGGAACCATTTGTTTGTTCCGGGACCTGTTAATATCCCTGAACAAGTTCTACGTGCTATGAACCGAAACAACGAAGATTACAGGTCCCCGGCTGTTCCAGCTCTCACAAAGACCTTGCTTGAGGATGTCAAGAAGATTTTCAAGACTACTAGTGGAACTCCATTTCTGTTCCCAACTACAGGAACTGGTGCATGGGAAAGTGCACTCACGAACACATTGTCTCCTGGTGATAGAACTGTATCATTCCTCATCGGTCAGTTCAGTCTGCTTTGGATTGATCAACAGAAACGACTCAACTTTGACGTTGATGTTATTGAGAGTGATTGGGGACAAGGTGCAAATCTTGAGGTTTTGGCCTCGAAAATTGCAGAAGATAAGTCTCATACCATCAAGGCGGTTTGCATCGTGCATAACGAGACAGCCACTGGAGTTACCAACAACTTGGCTACTGTAAGGAAAATACTCGATCACTACCAGCATCCTGCCCTCTTCCTTGTTGATGGAGTGTCCTCAATTTGTGCACTTGATTTCCGTATGGACGAATGGGGTGTAGATGTGGCTCTTACTGGTTCCCAGAAAGCACTTTCCCTTCCCACGGGGCTCGGGATAGTCTGTGCTAGCCCCAAGGCTCTTGAGGCCAGCAAAACTGCAAAATCAGTGAGAGTTTTCTTCGACTGGGGCGATTACCTGAAGTTCTACAAGCTGGGAACTTATTGGCCATATACTCCTTCCATCCAACTTTTGTATGGTCTGAGAGCAGCTCTCGACCTACTTTTCGAGGAAAGCCTTGATAAAGTGATTTGCAGACACGCTCGCCTTGGCAAAGCAACAAGACTTGCTGTGGAGGCATGGGGGCTTGAAGACTGCACTCAGAAGGAGGAATGGTTCAGTGATACAGTCACAGCCCG


Protein sequences

Name Description Sequence
Stu.2493 translated coding region predicted by ESTScan from UniGene Stu.2493

MDYVNGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLFPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQKRLNFDVDVIESDWGQGANLEVLASKIAEDKSHTIKAVCIVHNETATGVTNNLATVRKILDHYQHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKTAKSVRVFFDWGDYLKFYKLGTYWPYTPSIQLLYGLRAALDLLFEESLDKVICRHARLGKATRLAVEAWGLEDCTQKEEWFSDTVTAR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR21152:SF7
1-310 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MDYVNGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLFPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQKRLNFDVDVIESDWGQGANLEVLASKIAEDKSHTIKAVCIVHNETATGVTNNLATVRKILDHYQHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKTAKSVRVFFDWGDYLKFYKLGTYWPYTPSIQLLYGLRAALDLLFEESLDKVICRHARLGKATRLAVEAWGLEDCTQKEEWFSDTVTA

HMMPanther: PTHR21152
1-310 FAMILY NOT NAMED,AMINOTRANSFERASE CLASS V

MDYVNGPGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLFPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQKRLNFDVDVIESDWGQGANLEVLASKIAEDKSHTIKAVCIVHNETATGVTNNLATVRKILDHYQHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKTAKSVRVFFDWGDYLKFYKLGTYWPYTPSIQLLYGLRAALDLLFEESLDKVICRHARLGKATRLAVEAWGLEDCTQKEEWFSDTVTA

superfamily: SSF53383
IPR015424
7-310 PLP-dependent transferases
Pyridoxal phosphate-dependent transferase, major d

PGRNHLFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLFPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQKRLNFDVDVIESDWGQGANLEVLASKIAEDKSHTIKAVCIVHNETATGVTNNLATVRKILDHYQHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKTAKSVRVFFDWGDYLKFYKLGTYWPYTPSIQLLYGLRAALDLLFEESLDKVICRHARLGKATRLAVEAWGLEDCTQKEEWFSDTVTA

HMMPfam: PF00266
IPR000192
12-295 Aminotran_5
Aminotransferase, class V/Cysteine desulfurase

LFVPGPVNIPEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLFPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQKRLNFDVDVIESDWGQGANLEVLASKIAEDKSHTIKAVCIVHNETATGVTNNLATVRKILDHYQHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKTAKSVRVFFDWGDYLKFYKLGTYWPYTPSIQLLYGLRAALDLLFEESLDKVICRHARLGKATRLAVEAWGLE

Gene3D: G3DSA:3.40.640.10
IPR015421
21-257 no description
Pyridoxal phosphate-dependent transferase, major r

PEQVLRAMNRNNEDYRSPAVPALTKTLLEDVKKIFKTTSGTPFLFPTTGTGAWESALTNTLSPGDRTVSFLIGQFSLLWIDQQKRLNFDVDVIESDWGQGANLEVLASKIAEDKSHTIKAVCIVHNETATGVTNNLATVRKILDHYQHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKTAKSVRVFFDWGDYLKFYKLGTYWPYTPSIQLLY

Seg: seg
57-71 seg

TTSGTPFLFPTTGTG

PatternScan: PS00595
IPR020578
192-212 AA_TRANSFER_CLASS_5
Aminotransferase class-V pyridoxal-phosphate bindi

VDVALTGSQKALSLPTGLGIV

Seg: seg
255-266 seg

LLYGLRAALDLL

Gene3D: G3DSA:3.90.1150.10
IPR015422
258-310 no description
Pyridoxal phosphate-dependent transferase, major r

GLRAALDLLFEESLDKVICRHARLGKATRLAVEAWGLEDCTQKEEWFSDTVTA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox