PRGDB00077161 (Stu.2601)

From PRG Wiki
Jump to: navigation, search
Stu.2601
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 21927572 (BQ511941)
Gene Class Unknown
Domain Type
Gene Species Solanum tuberosum

Comment?

EST619356 Generation of a set of potato cDNA clones for microarray analyses mixed potato tissues Solanum tuberosum cDNA clone STMHV09 5' end, mRNA sequence

DNA Sequence

CCTTCATCTAACTCTTACTACTATAATTGTCACCTTTCTACTTTCATCTCttttgttttttgttttCCACCTTCATGGCTAACTTTAGCTTCATCCTCGGCATAATTGGGAATGTCATCTCCATACTTATGTTCGCTGCGCCAATAAAAACATTCAAAAGGATAATGAAGAAGAAATCAACAGAGGATTTTAAAGGGATACCATATATCACAACACTATTGAGCACATGTTTGTGGACATTTTATGGGTTACTCAAACCTGGAGGTTTGCTAGTGGTCACAGTCAATGGTACTGGTGCCATATTCCACATCATATATGTCACTCTCTTTCTCATTTATGTTCCCAAACCTCTTAAGATTCAATCAATGAAATTGGTGGCAATAATAAATATAGCATTTCTTGGGGTTGTAATTGCAATCACTTTACTAGCTGTGCACGGAACCACTCGACTCACATTAGTCGGATTTTTATGCGCTGCTTTGAATATTGGCATGTATGCAGCTCCTCTAGCAGCTACGAGGACAGTGATAAAAATGAAGAGTGTGGAGTACATGCCATTTTTCCTTTCCTTCTTCCAGTTCCTTAATGGAGGGGTATGGACTGCTTATGCAGTTCTTGTCAAAGATTATTTTATTGGAGTGCCAAATGGGATAGGCTTCATATTGGGCGCGGCCCAATTAATCCCTGTACTTATGTACTACAAGTCAAGCCCAACAAAATCGACAGAAGAAAAGGCTCGGCCCATCTAAATGAAAGAG


Protein sequences

Name Description Sequence
Stu.2601 translated coding region predicted by ESTScan from UniGene Stu.2601

MANFSFILGIIGNVISILMFAAPIKTFKRIMKKKSTEDFKGIPYITTLLSTCLWTFYGLLKPGGLLVVTVNGTGAIFHIIYVTLFLIYVPKPLKIQSMKLVAIINIAFLGVVIAITLLAVHGTTRLTLVGFLCAALNIGMYAAPLAATRTVIKMKSVEYMPFFLSFFQFLNGGVWTAYAVLVKDYFIGVPNGIGFILGAAQLIPVLMYYKSSPTKSTEEKARPI


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10791
IPR004316
6-220 RAG1-ACTIVATING PROTEIN 1
RAG1-activating protein-1-related

FILGIIGNVISILMFAAPIKTFKRIMKKKSTEDFKGIPYITTLLSTCLWTFYGLLKPGGLLVVTVNGTGAIFHIIYVTLFLIYVPKPLKIQSMKLVAIINIAFLGVVIAITLLAVHGTTRLTLVGFLCAALNIGMYAAPLAATRTVIKMKSVEYMPFFLSFFQFLNGGVWTAYAVLVKDYFIGVPNGIGFILGAAQLIPVLMYYKSSPTKSTEEK

HMMPfam: PF03083
IPR004316
6-91 MtN3_slv
RAG1-activating protein-1-related

FILGIIGNVISILMFAAPIKTFKRIMKKKSTEDFKGIPYITTLLSTCLWTFYGLLKPGGLLVVTVNGTGAIFHIIYVTLFLIYVPK

Seg: seg
63-74 seg

GGLLVVTVNGTG

HMMPfam: PF03083
IPR004316
128-211 MtN3_slv
RAG1-activating protein-1-related

LVGFLCAALNIGMYAAPLAATRTVIKMKSVEYMPFFLSFFQFLNGGVWTAYAVLVKDYFIGVPNGIGFILGAAQLIPVLMYYKS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox