PRGDB00077162 (Stu.2709)

From PRG Wiki
Jump to: navigation, search
Stu.2709
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 62809287 (DN850127)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Solanum tuberosum

Comment?

15416.2 Stolon Solanum tuberosum cDNA clone 15416 5', mRNA sequence

DNA Sequence

AGTCTCAAGCCTGAAAATTTGAATATGGATATGGTAAAAGAGTTCTCTCAAGAGGTCTTTATCATGAGGAAAATTCGGCACAAAAATGTTGTTCAATTTATAGGGGCATGCACACGACCTCCGAACCTGTGCATCGTGACAGAGTTCATGACCAGAGGAAGCATCTATACTTTTTTGCACAAGCAAAGAGGTGCTTTTAAGCTTCCTACTCTCCTGAAGGTTGCAATTGATGTTTCTAAGGGAATGAGCTATCTGCACCAAAATAACATAATTCATCGGGATCTGAAGACTGCCAATCTTCTGATGGATGAACATGGAGTTGTTAAGGTTGGTGACTTTGGGGTTGCTAGAGTGCAGACTCAAACAGGGGTGATGACTGCAGAAACTGGAACATATAGATGGATGGCTCCTGAGGTGATTGAACACAAACCGTATGACCACAAGGCTGATGTTTTCAGCTTTGGTATAGTGCTGTGGGAACTTCTGACTGGAGAAATTCCATATGCGTACTTAACACCATTACAAGCAGCAATAGGTGTGGTGCAACAGGGTCTACGGCCAACAATTCCTAAGGGCACTCATCCAAAGCTTGCTGAACTTCTTGAAAAATGCTGGCAGCAAGACCCAACTCAGAGACCAGATTTCTCGGAGATTTTGGATATTCTGAAGCAACTAACTATGGAGGTTGGAGATGATGGAGAGGACAGACACAAAGACAAATCAATCGGTAGCTTTTTCTCGTCTCTTAAAAGGGCAATCCACTGAGAATTTACTAAAGAGAGGAGGGTTGATCGGGCCTTCAACTTTTGTCTCGGGTGTACAGATTCTTCCAGATGACCAGACTTGATCTGATTAGGTTTTTGAAAATCACGGTTTCCATGTTAATGTCCGCTTGGGCATCTTTTTAACTATTCCCTAATTTTAGTCACGGGGTTCCAAGCTGGTGAAGTAAGGGTTTTGGGCAACTTC


Protein sequences

Name Description Sequence
Stu.2709 translated coding region predicted by ESTScan from UniGene Stu.2709

SLKPENLNMDMVKEFSQEVFIMRKIRHKNVVQFIGACTRPPNLCIVTEFMTRGSIYTFLHKQRGAFKLPTLLKVAIDVSKGMSYLHQNNIIHRDLKTANLLMDEHGVVKVGDFGVARVQTQTGVMTAETGTYRWMAPEVIEHKPYDHKADVFSFGIVLWELLTGEIPYAYLTPLQAAIGVVQQGLRPTIPKGTHPKLAELLEKCWQQDPTQRPDFSEILDILKQLTMEVGDDGEDRHKDKSIGSFFSSLKRAIH

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-227 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

SLKPENLNMDMVKEFSQEVFIMRKIRHKNVVQFIGACTRPPNLCIVTEFMTRGSIYTFLHKQRGAFKLPTLLKVAIDVSKGMSYLHQNNIIHRDLKTANLLMDEHGVVKVGDFGVARVQTQTGVMTAETGTYRWMAPEVIEHKPYDHKADVFSFGIVLWELLTGEIPYAYLTPLQAAIGVVQQGLRPTIPKGTHPKLAELLEKCWQQDPTQRPDFSEILDILKQLTM

HMMSmart: SM00219
IPR020635
1-222 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

SLKPENLNMDMVKEFSQEVFIMRKIRHKNVVQFIGACTRPPNLCIVTEFMTRGSIYTFLHKQRGAFKLPTLLKVAIDVSKGMSYLHQNNIIHRDLKTANLLMDEHGVVKVGDFGVARVQTQTGVMTAETGTYRWMAPEVIEHKPYDHKADVFSFGIVLWELLTGEIPYAYLTPLQAAIGVVQQGLRPTIPKGTHPKLAELLEKCWQQDPTQRPDFSEILDIL

superfamily: SSF56112
IPR011009
2-222 Protein kinase-like (PK-like)
Protein kinase-like domain

LKPENLNMDMVKEFSQEVFIMRKIRHKNVVQFIGACTRPPNLCIVTEFMTRGSIYTFLHKQRGAFKLPTLLKVAIDVSKGMSYLHQNNIIHRDLKTANLLMDEHGVVKVGDFGVARVQTQTGVMTAETGTYRWMAPEVIEHKPYDHKADVFSFGIVLWELLTGEIPYAYLTPLQAAIGVVQQGLRPTIPKGTHPKLAELLEKCWQQDPTQRPDFSEILDIL

HMMPanther: PTHR23257:SF82
2-232 PROTEIN KINASE ATMRK1,Ser-thr,PROTEIN KINASE ATMRK1

LKPENLNMDMVKEFSQEVFIMRKIRHKNVVQFIGACTRPPNLCIVTEFMTRGSIYTFLHKQRGAFKLPTLLKVAIDVSKGMSYLHQNNIIHRDLKTANLLMDEHGVVKVGDFGVARVQTQTGVMTAETGTYRWMAPEVIEHKPYDHKADVFSFGIVLWELLTGEIPYAYLTPLQAAIGVVQQGLRPTIPKGTHPKLAELLEKCWQQDPTQRPDFSEILDILKQLTMEVGDD

HMMPanther: PTHR23257
2-232 FAMILY NOT NAMED,Ser-thr,SERINE-THREONINE PROTEIN KINASE

LKPENLNMDMVKEFSQEVFIMRKIRHKNVVQFIGACTRPPNLCIVTEFMTRGSIYTFLHKQRGAFKLPTLLKVAIDVSKGMSYLHQNNIIHRDLKTANLLMDEHGVVKVGDFGVARVQTQTGVMTAETGTYRWMAPEVIEHKPYDHKADVFSFGIVLWELLTGEIPYAYLTPLQAAIGVVQQGLRPTIPKGTHPKLAELLEKCWQQDPTQRPDFSEILDILKQLTMEVGDD

HMMSmart: SM00220
IPR002290
5-227 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

ENLNMDMVKEFSQEVFIMRKIRHKNVVQFIGACTRPPNLCIVTEFMTRGSIYTFLHKQRGAFKLPTLLKVAIDVSKGMSYLHQNNIIHRDLKTANLLMDEHGVVKVGDFGVARVQTQTGVMTAETGTYRWMAPEVIEHKPYDHKADVFSFGIVLWELLTGEIPYAYLTPLQAAIGVVQQGLRPTIPKGTHPKLAELLEKCWQQDPTQRPDFSEILDILKQLTM

Gene3D: G3DSA:3.30.200.20
8-78 no description

NMDMVKEFSQEVFIMRKIRHKNVVQFIGACTRPPNLCIVTEFMTRGSIYTFLHKQRGAFKLPTLLKVAIDV

HMMPfam: PF07714
IPR001245
10-221 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

DMVKEFSQEVFIMRKIRHKNVVQFIGACTRPPNLCIVTEFMTRGSIYTFLHKQRGAFKLPTLLKVAIDVSKGMSYLHQNNIIHRDLKTANLLMDEHGVVKVGDFGVARVQTQTGVMTAETGTYRWMAPEVIEHKPYDHKADVFSFGIVLWELLTGEIPYAYLTPLQAAIGVVQQGLRPTIPKGTHPKLAELLEKCWQQDPTQRPDFSEILDI

FPrintScan: PR00109
IPR001245
47-60 TYRKINASE
Serine-threonine/tyrosine-protein kinase

TEFMTRGSIYTFLH

Gene3D: G3DSA:1.10.510.10
79-221 no description

SKGMSYLHQNNIIHRDLKTANLLMDEHGVVKVGDFGVARVQTQTGVMTAETGTYRWMAPEVIEHKPYDHKADVFSFGIVLWELLTGEIPYAYLTPLQAAIGVVQQGLRPTIPKGTHPKLAELLEKCWQQDPTQRPDFSEILDI

FPrintScan: PR00109
IPR001245
84-102 TYRKINASE
Serine-threonine/tyrosine-protein kinase

YLHQNNIIHRDLKTANLLM

PatternScan: PS00108
IPR008271
90-102 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKTANLLM

FPrintScan: PR00109
IPR001245
130-140 TYRKINASE
Serine-threonine/tyrosine-protein kinase

GTYRWMAPEVI

FPrintScan: PR00109
IPR001245
149-171 TYRKINASE
Serine-threonine/tyrosine-protein kinase

ADVFSFGIVLWELLTGEIPYAYL

FPrintScan: PR00109
IPR001245
193-215 TYRKINASE
Serine-threonine/tyrosine-protein kinase

THPKLAELLEKCWQQDPTQRPDF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox