PRGDB00077163 (Stu.2975)

From PRG Wiki
Jump to: navigation, search
Stu.2975
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 33563102 (AB091780)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Solanum tuberosum

Comment?

Solanum tuberosum StMEK2 mRNA for mitogen-activated protein kinase kinase, complete cds

DNA Sequence

ATGCGACCTCTTCAACCACCCCCACCAGCTGCCAACTCCACCTCCTCCGCCGCCGCATCATCCATGCCTCCTCCCTCTTCCGCCGGACAACGCAGTCGTCCCCGGCGTCGTACTGATTTGACCCTTCCTCTTCCTCAACGTGACGTTGCTCTTGCTGTTCctctcccccttcctccaacctccgctccttcctcttcctcatcctcatcttcctccccgcttccTACCCCTTTACATTTCTCTGAGCTCGAGAGGGTTAATCGCATCGGTAGTGGCACCGGAGGTACTGTTTACAAGGTTCTACATCGTCCCACTGGCAGACTCTATGCTTTGAAAGTTATCTATGGTAACCATGAGGATTCTGTCCGTCTCCAGATGTGCCGTGAGATCGAGATTCTCCGAGATGTAGACAACCCTAACGTCGTTAGGTGTCACGATATGTTCGATCACAACGGCGAAATCCAAGTTCTTCTTGAGTTCATGGATAAAGGCTCTCTCGAAGGGATCCATATCCCTCTCGAACAACCTCTCTCCGATCTAACTCGACAGGTTCTCTCCGGCCTCTACTACCTCCACAGGCGTAAGATTGTTCACAGAGATATCAAACCTTCTAACCTCTTAATCAACTCCAGGCGTGAGGTCAAGATTGCAGATTTTGGGGTCTCCAGAGTTCTCGCACAAACTATGGATCCTTGCAATTCCTCCGTGGGTACCATCGCTTACATGAGTCCCGAGAGAATCAACACAGATCTGAATCACGGACAGTACGACGGATATGCTGGGGACATATGGAGTCTTGGGGTGAGCATCTTAGAGTTCTACTTGGGAAGGTTCCCCTTCTCTGTGGGGAGACAAGGAGACTGGGCCAGCCTTATGTGCGCCATTTGTATGTCGCAGCCTCCTGAGGCACCACCCACTGCTTCCAGGGAGTTTAGGGAGTTCATTGCCTGCTGTTTGCAGAGGGATCCTGCTAGGCGGTGGACGGCCGCGCAGCTCTTGCGCCATCCCTTCATCACCCAGAATAGCCCAGGCACCCACACCGGTCCTGCTACTACCTCATTGAGTAATCAGGCACATCAATTGTTACCTCCACCTCCTCATTTttcttcttcttcttcttcttgacgttttaggttcggagtaattccacactcttttgtttttctattttacttaattttctggttttattttGTGTAATCTTAAATGTTGTTACTCTCTATTACTGATGGGGTGGTTGGATTTTATTTTTGGAGAA


Protein sequences

Name Description Sequence
Stu.2975 translated coding region predicted by ESTScan from UniGene Stu.2975

MRPLQPPPPAANSTSSAAASSMPPPSSAGQRSRPRRRTDLTLPLPQRDVALAVPLPLPPTSAPSSSSSSSSSPLPTPLHFSELERVNRIGSGTGGTVYKVLHRPTGRLYALKVIYGNHEDSVRLQMCREIEILRDVDNPNVVRCHDMFDHNGEIQVLLEFMDKGSLEGIHIPLEQPLSDLTRQVLSGLYYLHRRKIVHRDIKPSNLLINSRREVKIADFGVSRVLAQTMDPCNSSVGTIAYMSPERINTDLNHGQYDGYAGDIWSLGVSILEFYLGRFPFSVGRQGDWASLMCAICMSQPPEAPPTASREFREFIACCLQRDPARRWTAAQLLRHPFITQNSPGTHTGPATTSLSNQAHQLLPPPPHFSSSSSS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24361
9-343 PTHR24361,MITOGEN-ACTIVATED KINASE KINASE KINASE

PAANSTSSAAASSMPPPSSAGQRSRPRRRTDLTLPLPQRDVALAVPLPLPPTSAPSSSSSSSSSPLPTPLHFSELERVNRIGSGTGGTVYKVLHRPTGRLYALKVIYGNHEDSVRLQMCREIEILRDVDNPNVVRCHDMFDHNGEIQVLLEFMDKGSLEGIHIPLEQPLSDLTRQVLSGLYYLHRRKIVHRDIKPSNLLINSRREVKIADFGVSRVLAQTMDPCNSSVGTIAYMSPERINTDLNHGQYDGYAGDIWSLGVSILEFYLGRFPFSVGRQGDWASLMCAICMSQPPEAPPTASREFREFIACCLQRDPARRWTAAQLLRHPFITQNSP

HMMPanther: PTHR24361:SF31
9-343 PTHR24361:SF31

PAANSTSSAAASSMPPPSSAGQRSRPRRRTDLTLPLPQRDVALAVPLPLPPTSAPSSSSSSSSSPLPTPLHFSELERVNRIGSGTGGTVYKVLHRPTGRLYALKVIYGNHEDSVRLQMCREIEILRDVDNPNVVRCHDMFDHNGEIQVLLEFMDKGSLEGIHIPLEQPLSDLTRQVLSGLYYLHRRKIVHRDIKPSNLLINSRREVKIADFGVSRVLAQTMDPCNSSVGTIAYMSPERINTDLNHGQYDGYAGDIWSLGVSILEFYLGRFPFSVGRQGDWASLMCAICMSQPPEAPPTASREFREFIACCLQRDPARRWTAAQLLRHPFITQNSP

Gene3D: G3DSA:3.30.200.20
15-188 G3DSA:3.30.200.20

SSAAASSMPPPSSAGQRSRPRRRTDLTLPLPQRDVALAVPLPLPPTSAPSSSSSSSSSPLPTPLHFSELERVNRIGSGTGGTVYKVLHRPTGRLYALKVIYGNHEDSVRLQMCREIEILRDVDNPNVVRCHDMFDHNGEIQVLLEFMDKGSLEGIHIPLEQPLSDLTRQVLSGL

superfamily: SSF56112
IPR011009
69-369 Kinase_like
Protein kinase-like domain

SSSSPLPTPLHFSELERVNRIGSGTGGTVYKVLHRPTGRLYALKVIYGNHEDSVRLQMCREIEILRDVDNPNVVRCHDMFDHNGEIQVLLEFMDKGSLEGIHIPLEQPLSDLTRQVLSGLYYLHRRKIVHRDIKPSNLLINSRREVKIADFGVSRVLAQTMDPCNSSVGTIAYMSPERINTDLNHGQYDGYAGDIWSLGVSILEFYLGRFPFSVGRQGDWASLMCAICMSQPPEAPPTASREFREFIACCLQRDPARRWTAAQLLRHPFITQNSPGTHTGPATTSLSNQAHQLLPPPPHFS

ProfileScan: PS50011
IPR000719
83-338 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LERVNRIGSGTGGTVYKVLHRPTGRLYALKVIYGNHEDSVRLQMCREIEILRDVDNPNVVRCHDMFDHNGEIQVLLEFMDKGSLEGIHIPLEQPLSDLTRQVLSGLYYLHRRKIVHRDIKPSNLLINSRREVKIADFGVSRVLAQTMDPCNSSVGTIAYMSPERINTDLNHGQYDGYAGDIWSLGVSILEFYLGRFPFSVGRQGDWASLMCAICMSQPPEAPPTASREFREFIACCLQRDPARRWTAAQLLRHPFI

HMMSmart: SM00220
IPR002290
83-338 S_TKc
Serine/threonine-protein kinase domain

LERVNRIGSGTGGTVYKVLHRPTGRLYALKVIYGNHEDSVRLQMCREIEILRDVDNPNVVRCHDMFDHNGEIQVLLEFMDKGSLEGIHIPLEQPLSDLTRQVLSGLYYLHRRKIVHRDIKPSNLLINSRREVKIADFGVSRVLAQTMDPCNSSVGTIAYMSPERINTDLNHGQYDGYAGDIWSLGVSILEFYLGRFPFSVGRQGDWASLMCAICMSQPPEAPPTASREFREFIACCLQRDPARRWTAAQLLRHPFI

HMMPfam: PF00069
IPR017442
84-338 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

ERVNRIGSGTGGTVYKVLHRPTGRLYALKVIYGNHEDSVRLQMCREIEILRDVDNPNVVRCHDMFDHNGEIQVLLEFMDKGSLEGIHIPLEQPLSDLTRQVLSGLYYLHRRKIVHRDIKPSNLLINSRREVKIADFGVSRVLAQTMDPCNSSVGTIAYMSPERINTDLNHGQYDGYAGDIWSLGVSILEFYLGRFPFSVGRQGDWASLMCAICMSQPPEAPPTASREFREFIACCLQRDPARRWTAAQLLRHPFI

PatternScan: PS00107
IPR017441
89-112 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGSGTGGTVYKVLHRPTGRLYALK

Gene3D: G3DSA:1.10.510.10
189-346 G3DSA:1.10.510.10

YYLHRRKIVHRDIKPSNLLINSRREVKIADFGVSRVLAQTMDPCNSSVGTIAYMSPERINTDLNHGQYDGYAGDIWSLGVSILEFYLGRFPFSVGRQGDWASLMCAICMSQPPEAPPTASREFREFIACCLQRDPARRWTAAQLLRHPFITQNSPGTH

PatternScan: PS00108
IPR008271
196-208 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDIKPSNLLI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox