PRGDB00077166 (Stu.3521)

From PRG Wiki
Jump to: navigation, search
Stu.3521
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 39804669 (CK251542)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Solanum tuberosum

Comment?

EST735179 potato callus cDNA library, normalized and full-length Solanum tuberosum cDNA clone POCBO25 5' end, mRNA sequence

DNA Sequence

GATCTCAACTGTCCACTCTAGTTCTTCACGCCACTCGAAAAGACCTAGAGAATCTCAAGATCTTGGTTTCAAACTGCTGAAAAACATTAATCTTAAAGAAAAAAGTGATCTCCGGTAATGTCTACTGGGCTCCCCGGAGTGCCGTTGGGTCCGCCGTTGCCGTTTCCTCCGGCGGATAATGCAACTACTCCAACATCTCCGGTGAACCCAAGTACTACTCCTCCGTCTCCAGATGTTGCTAGTCAGCCTTCTCCGGCGACCTTGGTAAATCCGCCGCCCTCATCGATTAATGGAAGCTCTCCAACGAGTGCTCCGCCGAAGGGGTCGGCGAATAATACTACTTTAGTAGCACTTGGAGTTGGAATTGGGATTGGAGGAGCACTTGTGCTTATATGCGTGTGCATTTTTGCCCTTTGGTATAAGAGGAGAAAAAGGCGTCTTGGGTTAAATGGTTTTGGTCATGATCCATCTTCACAAGGTCCTAAAGATAATTTGTTTGGTGGTCAACATCATCACTGGCAACAAAATGCTCCTCCCTCAGCAGAAAACATGGTGAGGATTCCAATAAATCCCTCCCCTCCACCATCCATTACATCAGTTTCACAAGTATCTGCAGCAGATGGATGTACTCCTCCACTGCCACCTTCCACTGGCAGTAACTTCAGTACTGACAAACCTTTTCAACAAACAAATCCTGATTCCAACTTGAGTTTCTCGAGAACTACATTCACCTATCAAGAATTAGCATTTGCTACCGATAATTTCTCTGTCGCCAACCTCCTTGGTCAAGGTGGTTTTGGATATGTATACAAGGGAGTATTCCGTGATGGGAAGGAGGTTGCAATTAAGCAACTAAAAGCTGGAAGTGGGCAGGGGGAGCGTGAATTTCCAGCAGAGGTGGAGATTATTAGTCACGTTCATCACAAGC


Protein sequences

Name Description Sequence
Stu.3521 translated coding region predicted by ESTScan from UniGene Stu.3521

MSTGLPGVPLGPPLPFPPADNATTPTSPVNPSTTPPSPDVASQPSPATLVNPPPSSINGSSPTSAPPKGSANNTTLVALGVGIGIGGALVLICVCIFALWYKRRKRRLGLNGFGHDPSSQGPKDNLFGGQHHHWQQNAPPSAENMVRIPINPSPPPSITSVSQVSAADGCTPPLPPSTGSNFSTDKPFQQTNPDSNLSFSRTTFTYQELAFATDNFSVANLLGQGGFGYVYKGVFRDGKEVAIKQLKAGSGQGEREFPAEVEIISHVHHKX

Domains

Domain Start-End Description Sequence

Seg: seg
4-18 seg

GLPGVPLGPPLPFPP

HMMPanther: PTHR24420:SF822
21-270 SUBFAMILY NOT NAMED

NATTPTSPVNPSTTPPSPDVASQPSPATLVNPPPSSINGSSPTSAPPKGSANNTTLVALGVGIGIGGALVLICVCIFALWYKRRKRRLGLNGFGHDPSSQGPKDNLFGGQHHHWQQNAPPSAENMVRIPINPSPPPSITSVSQVSAADGCTPPLPPSTGSNFSTDKPFQQTNPDSNLSFSRTTFTYQELAFATDNFSVANLLGQGGFGYVYKGVFRDGKEVAIKQLKAGSGQGEREFPAEVEIISHVHHK

HMMPanther: PTHR24420
21-270 FAMILY NOT NAMED,FAMILY NOT NAMED

NATTPTSPVNPSTTPPSPDVASQPSPATLVNPPPSSINGSSPTSAPPKGSANNTTLVALGVGIGIGGALVLICVCIFALWYKRRKRRLGLNGFGHDPSSQGPKDNLFGGQHHHWQQNAPPSAENMVRIPINPSPPPSITSVSQVSAADGCTPPLPPSTGSNFSTDKPFQQTNPDSNLSFSRTTFTYQELAFATDNFSVANLLGQGGFGYVYKGVFRDGKEVAIKQLKAGSGQGEREFPAEVEIISHVHHK

Seg: seg
23-38 seg

TTPTSPVNPSTTPPSP

Seg: seg
52-66 seg

PPPSSINGSSPTSAP

Seg: seg
76-92 seg

LVALGVGIGIGGALVLI

Seg: seg
146-165 seg

VRIPINPSPPPSITSVSQVS

superfamily: SSF56112
IPR011009
188-270 Protein kinase-like (PK-like)
Protein kinase-like domain

FQQTNPDSNLSFSRTTFTYQELAFATDNFSVANLLGQGGFGYVYKGVFRDGKEVAIKQLKAGSGQGEREFPAEVEIISHVHHK

Gene3D: G3DSA:3.30.200.20
199-270 no description

FSRTTFTYQELAFATDNFSVANLLGQGGFGYVYKGVFRDGKEVAIKQLKAGSGQGEREFPAEVEIISHVHHK

ProfileScan: PS50011
IPR000719
216-271 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSVANLLGQGGFGYVYKGVFRDGKEVAIKQLKAGSGQGEREFPAEVEIISHVHHKX

HMMPfam: PF07714
IPR001245
219-270 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

ANLLGQGGFGYVYKGVFRDGKEVAIKQLKAGSGQGEREFPAEVEIISHVHHK

PatternScan: PS00107
IPR017441
222-244 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGQGGFGYVYKGVFRDGKEVAIK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox