PRGDB00077167 (Stu.3544)

From PRG Wiki
Jump to: navigation, search
Stu.3544
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 39798822 (CK248564)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Solanum tuberosum

Comment?

EST732201 potato callus cDNA library, normalized and full-length Solanum tuberosum cDNA clone POCB190 5' end, mRNA sequence

DNA Sequence

CGCTTTATGTCTTTACGAACCCCTCAAACCTTCACCCACtcttcttcttcttcttcttcCTCAGTTATGGCCTCTGCCTCTTCACTTTTTTCTCAAAACcccattttttcttctttacattactactatttctcttcttcctttaacttactttATTATGGGTTATCTTTCATGCAATGCCGAATCCGCTATTGCCACCTGCGATTCTTATAACTGGAACTTCAAAAAGAATCGAACTCATAATAAACCATTTACAATCAGAGAGTTTTCTTACTCTGATCTTCACTCTGCTACTAATGCATTTTCTCAGGATAATCTTCTTGGTAAAGGAAGCCATGGATATGTATACAGAGCTCATCTTAATCAAACTAAGCTCACTGTTGTAGCTGTTAAAAGGGGTAAATTAACTGAACCCCGTAACAGTTCTACTAATTCTCCGGCGGAAAATGAGATTGAGATTCTTTCTAGAGTACACCACCCTCGGTTGGTTAACTTGTTGGGTTATGCGGTGGACTCGAATCAGAATAAATTGATTGTTGTCGAGTTTATGCCTAATGGGTCTTTGTATGAATTGCTTCATTCTCATTCTAAACCTCCTAATTGGACTCGTCGTGTTCGATTTGCTTTACAAATTGCTAGGGGTGTTCATTTTTTACATTCTTCAAATCCGCCGGTGATTCATAGAGATATCAAGTCTTCCAATATTCTAATCGATGGGAATTTCAGTGCTCGTCTTGGTGATTTTGGGTTGTCTTTGAGAGGTCATGTTGAAGATGTCGTCGTTAAAAGTACGCCGCCGGCGGGTACGTTGGGGTATTTGGATCCTGCTTATCTAGCACCGAGTGATCTCAGTACAAAATCTGACGTTTTCAGCTTTGGGATTTTATTACTAGAGATCATTAGTGGGCGGAACGCAATCGACGTGAATTACAGTCCGCCATCAGTGGTGGATTGGGCTGTGCCGTTG


Protein sequences

Name Description Sequence
Stu.3544 translated coding region predicted by ESTScan from UniGene Stu.3544

MGYLSCNAESAIATCDSYNWNFKKNRTHNKPFTIREFSYSDLHSATNAFSQDNLLGKGSHGYVYRAHLNQTKLTVVAVKRGKLTEPRNSSTNSPAENEIEILSRVHHPRLVNLLGYAVDSNQNKLIVVEFMPNGSLYELLHSHSKPPNWTRRVRFALQIARGVHFLHSSNPPVIHRDIKSSNILIDGNFSARLGDFGLSLRGHVEDVVVKSTPPAGTLGYLDPAYLAPSDLSTKSDVFSFGILLLEIISGRNAIDVNYSPPSVVDWAVPL

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.30.200.20
14-115 no description

TCDSYNWNFKKNRTHNKPFTIREFSYSDLHSATNAFSQDNLLGKGSHGYVYRAHLNQTKLTVVAVKRGKLTEPRNSSTNSPAENEIEILSRVHHPRLVNLLG

HMMPanther: PTHR24420:SF439
20-270 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

WNFKKNRTHNKPFTIREFSYSDLHSATNAFSQDNLLGKGSHGYVYRAHLNQTKLTVVAVKRGKLTEPRNSSTNSPAENEIEILSRVHHPRLVNLLGYAVDSNQNKLIVVEFMPNGSLYELLHSHSKPPNWTRRVRFALQIARGVHFLHSSNPPVIHRDIKSSNILIDGNFSARLGDFGLSLRGHVEDVVVKSTPPAGTLGYLDPAYLAPSDLSTKSDVFSFGILLLEIISGRNAIDVNYSPPSVVDWAVPL

HMMPanther: PTHR24420
20-270 FAMILY NOT NAMED,FAMILY NOT NAMED

WNFKKNRTHNKPFTIREFSYSDLHSATNAFSQDNLLGKGSHGYVYRAHLNQTKLTVVAVKRGKLTEPRNSSTNSPAENEIEILSRVHHPRLVNLLGYAVDSNQNKLIVVEFMPNGSLYELLHSHSKPPNWTRRVRFALQIARGVHFLHSSNPPVIHRDIKSSNILIDGNFSARLGDFGLSLRGHVEDVVVKSTPPAGTLGYLDPAYLAPSDLSTKSDVFSFGILLLEIISGRNAIDVNYSPPSVVDWAVPL

superfamily: SSF56112
IPR011009
21-251 Protein kinase-like (PK-like)
Protein kinase-like domain

NFKKNRTHNKPFTIREFSYSDLHSATNAFSQDNLLGKGSHGYVYRAHLNQTKLTVVAVKRGKLTEPRNSSTNSPAENEIEILSRVHHPRLVNLLGYAVDSNQNKLIVVEFMPNGSLYELLHSHSKPPNWTRRVRFALQIARGVHFLHSSNPPVIHRDIKSSNILIDGNFSARLGDFGLSLRGHVEDVVVKSTPPAGTLGYLDPAYLAPSDLSTKSDVFSFGILLLEIISGR

ProfileScan: PS50011
IPR000719
49-270 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSQDNLLGKGSHGYVYRAHLNQTKLTVVAVKRGKLTEPRNSSTNSPAENEIEILSRVHHPRLVNLLGYAVDSNQNKLIVVEFMPNGSLYELLHSHSKPPNWTRRVRFALQIARGVHFLHSSNPPVIHRDIKSSNILIDGNFSARLGDFGLSLRGHVEDVVVKSTPPAGTLGYLDPAYLAPSDLSTKSDVFSFGILLLEIISGRNAIDVNYSPPSVVDWAVPL

HMMSmart: SM00219
IPR020635
49-268 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSQDNLLGKGSHGYVYRAHLNQTKLTVVAVKRGKLTEPRNSSTNSPAENEIEILSRVHHPRLVNLLGYAVDSNQNKLIVVEFMPNGSLYELLHSHSKPPNWTRRVRFALQIARGVHFLHSSNPPVIHRDIKSSNILIDGNFSARLGDFGLSLRGHVEDVVVKSTPPAGTLGYLDPAYLAPSDLSTKSDVFSFGILLLEIISGRNAIDVNYSPPSVVDWAV

HMMSmart: SM00220
IPR002290
49-267 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSQDNLLGKGSHGYVYRAHLNQTKLTVVAVKRGKLTEPRNSSTNSPAENEIEILSRVHHPRLVNLLGYAVDSNQNKLIVVEFMPNGSLYELLHSHSKPPNWTRRVRFALQIARGVHFLHSSNPPVIHRDIKSSNILIDGNFSARLGDFGLSLRGHVEDVVVKSTPPAGTLGYLDPAYLAPSDLSTKSDVFSFGILLLEIISGRNAIDVNYSPPSVVDWA

HMMPfam: PF07714
IPR001245
52-250 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

DNLLGKGSHGYVYRAHLNQTKLTVVAVKRGKLTEPRNSSTNSPAENEIEILSRVHHPRLVNLLGYAVDSNQNKLIVVEFMPNGSLYELLHSHSKPPNWTRRVRFALQIARGVHFLHSSNPPVIHRDIKSSNILIDGNFSARLGDFGLSLRGHVEDVVVKSTPPAGTLGYLDPAYLAPSDLSTKSDVFSFGILLLEIISG

PatternScan: PS00107
IPR017441
55-79 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGKGSHGYVYRAHLNQTKLTVVAVK

Gene3D: G3DSA:1.10.510.10
116-254 no description

YAVDSNQNKLIVVEFMPNGSLYELLHSHSKPPNWTRRVRFALQIARGVHFLHSSNPPVIHRDIKSSNILIDGNFSARLGDFGLSLRGHVEDVVVKSTPPAGTLGYLDPAYLAPSDLSTKSDVFSFGILLLEIISGRNAI

PatternScan: PS00108
IPR008271
173-185 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDIKSSNILI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox