PRGDB00077168 (Stu.3578)

From PRG Wiki
Jump to: navigation, search
Stu.3578
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 39813730 (CK256750)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Solanum tuberosum

Comment?

EST740387 potato callus cDNA library, normalized and full-length Solanum tuberosum cDNA clone POCCV78 5' end, mRNA sequence

DNA Sequence

GATGTAAAACTAAGGTGATAAATTAATGCATCTCTGTTTTCAGATTTATTCTACAAAAAACACAATCAGAAATTACCTTGTGCTCAGTGATAGCTTAAATAATGTTATTTGAAGGTTATTAGTAATACTCAACCATGGGAAGCAAGTATTCCAAGGCAACAAATTCCATAAATGATGCTTTAAACTCGAGTTATCGCGTTCCTTTTGAAAGTTTTCGAGTTCCTTTTGTAGATTTGCAGGAAGCAACTAACAACTTCGATGAGAAGTTTCACATTGGATTGGGTGGCTTTGGGAAAGTTTACAGGGGTGTTTTGCGTGATGGAACAAAGGTGGCCCTGAAGAGGTGTAAGCGTGAGTCCTCACAAGGTATTGAAGAGTTCCGAACAGAAATTGAGATTCTCTCTTTTTGCAGCCATCCGCATTTGGTTTCATTGATAGGATACTGTGATGAAACAAATGAGATGATTCTAGTTTATGACTACATTGAGAATGGGAACCTCAGGAGCCATTTGTATGGCCCAGATCTACCCACTATGAGCTGGGAGCAGAGGCTGGAGATATGCATCGGGGCAGCCAGAGGTCTGCATTACCTTCATACTAGCGCAGTTATACATCGTGATGTCAAGTCTATAAACATATTGCTTGATGAGAATTTTGTGGCAAAAATTACTGATTTTGGAATATCCAAGAAAGGGACTGAGCTTGATCAAACCCATCTTAGCACCCTTGTGCAAGGAACTATAGGCTACCTTGACCCTGAATATTTTATACGGGGACAACTGACAGAAAAATCTGATGTTTATTCTTTCGGTGTTGTTTTATTCGAAAGTCTTTGTGCTAGGCCTGCCATAGTTCAATCTCTTCCAAGGGAGATGGTTAATTTAGCTGAATGGGCAGTGGACTCGCATAAT


Protein sequences

Name Description Sequence
Stu.3578 translated coding region predicted by ESTScan from UniGene Stu.3578

MGSKYSKATNSINDALNSSYRVPFESFRVPFVDLQEATNNFDEKFHIGLGGFGKVYRGVLRDGTKVALKRCKRESSQGIEEFRTEIEILSFCSHPHLVSLIGYCDETNEMILVYDYIENGNLRSHLYGPDLPTMSWEQRLEICIGAARGLHYLHTSAVIHRDVKSINILLDENFVAKITDFGISKKGTELDQTHLSTLVQGTIGYLDPEYFIRGQLTEKSDVYSFGVVLFESLCARPAIVQSLPREMVNLAEWAVDSHN

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
13-253 Protein kinase-like (PK-like)
Protein kinase-like domain

NDALNSSYRVPFESFRVPFVDLQEATNNFDEKFHIGLGGFGKVYRGVLRDGTKVALKRCKRESSQGIEEFRTEIEILSFCSHPHLVSLIGYCDETNEMILVYDYIENGNLRSHLYGPDLPTMSWEQRLEICIGAARGLHYLHTSAVIHRDVKSINILLDENFVAKITDFGISKKGTELDQTHLSTLVQGTIGYLDPEYFIRGQLTEKSDVYSFGVVLFESLCARPAIVQSLPREMVNLAEW

HMMPanther: PTHR24420:SF785
25-255 SUBFAMILY NOT NAMED

ESFRVPFVDLQEATNNFDEKFHIGLGGFGKVYRGVLRDGTKVALKRCKRESSQGIEEFRTEIEILSFCSHPHLVSLIGYCDETNEMILVYDYIENGNLRSHLYGPDLPTMSWEQRLEICIGAARGLHYLHTSAVIHRDVKSINILLDENFVAKITDFGISKKGTELDQTHLSTLVQGTIGYLDPEYFIRGQLTEKSDVYSFGVVLFESLCARPAIVQSLPREMVNLAEWAV

HMMPanther: PTHR24420
25-255 FAMILY NOT NAMED,FAMILY NOT NAMED

ESFRVPFVDLQEATNNFDEKFHIGLGGFGKVYRGVLRDGTKVALKRCKRESSQGIEEFRTEIEILSFCSHPHLVSLIGYCDETNEMILVYDYIENGNLRSHLYGPDLPTMSWEQRLEICIGAARGLHYLHTSAVIHRDVKSINILLDENFVAKITDFGISKKGTELDQTHLSTLVQGTIGYLDPEYFIRGQLTEKSDVYSFGVVLFESLCARPAIVQSLPREMVNLAEWAV

Gene3D: G3DSA:3.30.200.20
29-102 no description

VPFVDLQEATNNFDEKFHIGLGGFGKVYRGVLRDGTKVALKRCKRESSQGIEEFRTEIEILSFCSHPHLVSLIG

ProfileScan: PS50011
IPR000719
41-259 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FDEKFHIGLGGFGKVYRGVLRDGTKVALKRCKRESSQGIEEFRTEIEILSFCSHPHLVSLIGYCDETNEMILVYDYIENGNLRSHLYGPDLPTMSWEQRLEICIGAARGLHYLHTSAVIHRDVKSINILLDENFVAKITDFGISKKGTELDQTHLSTLVQGTIGYLDPEYFIRGQLTEKSDVYSFGVVLFESLCARPAIVQSLPREMVNLAEWAVDSHN

HMMSmart: SM00220
IPR002290
41-254 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FDEKFHIGLGGFGKVYRGVLRDGTKVALKRCKRESSQGIEEFRTEIEILSFCSHPHLVSLIGYCDETNEMILVYDYIENGNLRSHLYGPDLPTMSWEQRLEICIGAARGLHYLHTSAVIHRDVKSINILLDENFVAKITDFGISKKGTELDQTHLSTLVQGTIGYLDPEYFIRGQLTEKSDVYSFGVVLFESLCARPAIVQSLPREMVNLAEWA

HMMSmart: SM00219
IPR020635
41-259 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FDEKFHIGLGGFGKVYRGVLRDGTKVALKRCKRESSQGIEEFRTEIEILSFCSHPHLVSLIGYCDETNEMILVYDYIENGNLRSHLYGPDLPTMSWEQRLEICIGAARGLHYLHTSAVIHRDVKSINILLDENFVAKITDFGISKKGTELDQTHLSTLVQGTIGYLDPEYFIRGQLTEKSDVYSFGVVLFESLCARPAIVQSLPREMVNLAEWAVDSHN

HMMPfam: PF07714
IPR001245
46-234 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

HIGLGGFGKVYRGVLRDGTKVALKRCKRESSQGIEEFRTEIEILSFCSHPHLVSLIGYCDETNEMILVYDYIENGNLRSHLYGPDLPTMSWEQRLEICIGAARGLHYLHTSAVIHRDVKSINILLDENFVAKITDFGISKKGTELDQTHLSTLVQGTIGYLDPEYFIRGQLTEKSDVYSFGVVLFESLC

PatternScan: PS00107
IPR017441
47-69 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGLGGFGKVYRGVLRDGTKVALK

Gene3D: G3DSA:1.10.510.10
103-247 no description

YCDETNEMILVYDYIENGNLRSHLYGPDLPTMSWEQRLEICIGAARGLHYLHTSAVIHRDVKSINILLDENFVAKITDFGISKKGTELDQTHLSTLVQGTIGYLDPEYFIRGQLTEKSDVYSFGVVLFESLCARPAIVQSLPREM

PatternScan: PS00108
IPR008271
158-170 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDVKSINILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox