PRGDB00077169 (Stu.3612)

From PRG Wiki
Jump to: navigation, search
Stu.3612
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 39786910 (CK242864)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Solanum tuberosum

Comment?

EST726501 potato callus cDNA library, normalized and full-length Solanum tuberosum cDNA clone POCA151 5' end, mRNA sequence

DNA Sequence

ATCTTCTGCAACTTCCCCTCTCCTCCATCCGCCGTCGTCGCCGCCGCCGTGGTTGTCGTCGCCGGGATGGATGTAAAACAACCCCAACCACCTCCTTCCACCGTCAAAATCAGAAGAACCACCAGTTCCGACGGTAGTGGATCTGGATCTATCATTCTTGGGAAATACCAATTGGGTCGTCTATTGGGTCGAGGTAGCTTTGCTAAAGTGTACCTTGGCCGTTGTTTAGATGATAATACTGAAGTTGCTGTTAAAATTATTGATAAATCCAGTACTACTATTGATGCTTCTATGGAGCCACGGATTATCCGTGAAGTCTCCGCCATGCGCCGCCTTAATCACCACCCGAATATCCTCGAACTTTTTGAAGTTATGGCTACGAAAACTAAGATCTATTTCGTTATGGAACTAGCTCACGGCGGTGAGCTTTTCACGAAGCTTAACCGCCGTGGCCGGTTTTCTGAATCCACCGCTCGGTTTTATTTCCATCAGCTTGTCTCCGCTTTACACTTCTGCCACCAAAACGGCGTTGCACATCGTGATATCAAGCCACAAAATCTACTCCTAGACAAAGAGGGTCACCTCAAAATCTCCGATTTCGGACTCTCCGCCTTGCCGGAGCAGTTACAGAACGGTCTCCTTCATACCGCGTGTGGTACGCCGGCGTATACTGCTCCGGAGGTGGTTTACAGAAGAGGGTACGACGGAGCTAAGGCGGATGCTTGGTCATGTGGGGTTATTCTCTTTGTGTTCCTCGCCGGTAGCTTACCGTTCAATGATAGCAATTTGCCTAACATGTATAAAGCTATACACCGGCGTGAATATCAGTTTCCCGATTGGGTTTCAAAGTCAGCTCGGAGGATAATTAACCGACTGCTTGATCCTAATCCGGAAACGAGATACGGAATTTGAAGAGCTCATGAACACTGTATGGTTTAAGAAATCACTGTCGATGAAACCAGAACCAAGCACGAA


Protein sequences

Name Description Sequence
Stu.3612 translated coding region predicted by ESTScan from UniGene Stu.3612

IFCNFPSPPSAVVAAAVVVVAGMDVKQPQPPPSTVKIRRTTSSDGSGSGSIILGKYQLGRLLGRGSFAKVYLGRCLDDNTEVAVKIIDKSSTTIDASMEPRIIREVSAMRRLNHHPNILELFEVMATKTKIYFVMELAHGGELFTKLNRRGRFSESTARFYFHQLVSALHFCHQNGVAHRDIKPQNLLLDKEGHLKISDFGLSALPEQLQNGLLHTACGTPAYTAPEVVYRRGYDGAKADAWSCGVILFVFLAGSLPFNDSNLPNMYKAIHRREYQFPDWVSKSARRIINRLLDPNRKRDTEFEELMNTVWFKKSLSMKPEPSTX

Domains

Domain Start-End Description Sequence

Seg: seg
11-21 seg

AVVAAAVVVVA

Gene3D: G3DSA:3.30.200.20
33-156 no description

STVKIRRTTSSDGSGSGSIILGKYQLGRLLGRGSFAKVYLGRCLDDNTEVAVKIIDKSSTTIDASMEPRIIREVSAMRRLNHHPNILELFEVMATKTKIYFVMELAHGGELFTKLNRRGRFSES

superfamily: SSF56112
IPR011009
42-322 Protein kinase-like (PK-like)
Protein kinase-like domain

SSDGSGSGSIILGKYQLGRLLGRGSFAKVYLGRCLDDNTEVAVKIIDKSSTTIDASMEPRIIREVSAMRRLNHHPNILELFEVMATKTKIYFVMELAHGGELFTKLNRRGRFSESTARFYFHQLVSALHFCHQNGVAHRDIKPQNLLLDKEGHLKISDFGLSALPEQLQNGLLHTACGTPAYTAPEVVYRRGYDGAKADAWSCGVILFVFLAGSLPFNDSNLPNMYKAIHRREYQFPDWVSKSARRIINRLLDPNRKRDTEFEELMNTVWFKKSLSMKPEP

Seg: seg
42-50 seg

SSDGSGSGS

HMMPanther: PTHR24343:SF130
48-318 SUBFAMILY NOT NAMED

SGSIILGKYQLGRLLGRGSFAKVYLGRCLDDNTEVAVKIIDKSSTTIDASMEPRIIREVSAMRRLNHHPNILELFEVMATKTKIYFVMELAHGGELFTKLNRRGRFSESTARFYFHQLVSALHFCHQNGVAHRDIKPQNLLLDKEGHLKISDFGLSALPEQLQNGLLHTACGTPAYTAPEVVYRRGYDGAKADAWSCGVILFVFLAGSLPFNDSNLPNMYKAIHRREYQFPDWVSKSARRIINRLLDPNRKRDTEFEELMNTVWFKKSLSM

HMMPanther: PTHR24343
48-318 FAMILY NOT NAMED,SERINE/THREONINE KINASE

SGSIILGKYQLGRLLGRGSFAKVYLGRCLDDNTEVAVKIIDKSSTTIDASMEPRIIREVSAMRRLNHHPNILELFEVMATKTKIYFVMELAHGGELFTKLNRRGRFSESTARFYFHQLVSALHFCHQNGVAHRDIKPQNLLLDKEGHLKISDFGLSALPEQLQNGLLHTACGTPAYTAPEVVYRRGYDGAKADAWSCGVILFVFLAGSLPFNDSNLPNMYKAIHRREYQFPDWVSKSARRIINRLLDPNRKRDTEFEELMNTVWFKKSLSM

ProfileScan: PS50011
IPR000719
56-312 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YQLGRLLGRGSFAKVYLGRCLDDNTEVAVKIIDKSSTTIDASMEPRIIREVSAMRRLNHHPNILELFEVMATKTKIYFVMELAHGGELFTKLNRRGRFSESTARFYFHQLVSALHFCHQNGVAHRDIKPQNLLLDKEGHLKISDFGLSALPEQLQNGLLHTACGTPAYTAPEVVYRRGYDGAKADAWSCGVILFVFLAGSLPFNDSNLPNMYKAIHRREYQFPDWVSKSARRIINRLLDPNRKRDTEFEELMNTVWF

HMMPfam: PF00069
IPR017442
56-312 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YQLGRLLGRGSFAKVYLGRCLDDNTEVAVKIIDKSSTTIDASMEPRIIREVSAMRRLNHHPNILELFEVMATKTKIYFVMELAHGGELFTKLNRRGRFSESTARFYFHQLVSALHFCHQNGVAHRDIKPQNLLLDKEGHLKISDFGLSALPEQLQNGLLHTACGTPAYTAPEVVYRRGYDGAKADAWSCGVILFVFLAGSLPFNDSNLPNMYKAIHRREYQFPDWVSKSARRIINRLLDPNRKRDTEFEELMNTVWF

HMMSmart: SM00219
IPR020635
56-310 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YQLGRLLGRGSFAKVYLGRCLDDNTEVAVKIIDKSSTTIDASMEPRIIREVSAMRRLNHHPNILELFEVMATKTKIYFVMELAHGGELFTKLNRRGRFSESTARFYFHQLVSALHFCHQNGVAHRDIKPQNLLLDKEGHLKISDFGLSALPEQLQNGLLHTACGTPAYTAPEVVYRRGYDGAKADAWSCGVILFVFLAGSLPFNDSNLPNMYKAIHRREYQFPDWVSKSARRIINRLLDPNRKRDTEFEELMNTV

HMMSmart: SM00220
IPR002290
56-312 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YQLGRLLGRGSFAKVYLGRCLDDNTEVAVKIIDKSSTTIDASMEPRIIREVSAMRRLNHHPNILELFEVMATKTKIYFVMELAHGGELFTKLNRRGRFSESTARFYFHQLVSALHFCHQNGVAHRDIKPQNLLLDKEGHLKISDFGLSALPEQLQNGLLHTACGTPAYTAPEVVYRRGYDGAKADAWSCGVILFVFLAGSLPFNDSNLPNMYKAIHRREYQFPDWVSKSARRIINRLLDPNRKRDTEFEELMNTVWF

PatternScan: PS00107
IPR017441
62-85 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGRGSFAKVYLGRCLDDNTEVAVK

Gene3D: G3DSA:1.10.510.10
157-315 no description

TARFYFHQLVSALHFCHQNGVAHRDIKPQNLLLDKEGHLKISDFGLSALPEQLQNGLLHTACGTPAYTAPEVVYRRGYDGAKADAWSCGVILFVFLAGSLPFNDSNLPNMYKAIHRREYQFPDWVSKSARRIINRLLDPNRKRDTEFEELMNTVWFKKS

PatternScan: PS00108
IPR008271
177-189 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VAHRDIKPQNLLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox