PRGDB00077170 (Stu.3614)

From PRG Wiki
Jump to: navigation, search
Stu.3614
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 39787140 (CK242979)
Gene Class Unknown
Domain Type
Gene Species Solanum tuberosum

Comment?

EST726616 potato callus cDNA library, normalized and full-length Solanum tuberosum cDNA clone POCA195 5' end, mRNA sequence

DNA Sequence

GATATTATTCAACAGAGCATTATTGATTCTTGAAATTGGATTTCCTAACTGAACTAGAAGACCTCACTGTAGCTTTTGAAAGATCAAACACAAACGACAGTGGGTCCTCTGTAGCGACAAATCGGCCGTGGGATTTTTACTTCCCTTCGAATTTGAAAAAATTGCATCTGCTTGAGTTTCCTCTGACATCCGATTCACTATCAACAATAGCGAGACTGCCCAACCTTGAAGAGTTGACCCTTTATCGTACAATCATCCATGGGGGAGGAAGACACCTTTGAGAATCTCAAATATTTGAAGTTGGAACAAGTGACTCTTTCCAAGTGGGAGGTTGGAGAGGAATCCTTTCCTGCGCTTGAGAAATTAAAACTGTGGGGATGTCGTAAGCTTGAGGAGATTCCGCCTAGTTTTGGGGATATTAATTCATTGAAAATTATAAAACTTGTAAAGAGCCCTCAACTTGAAGATTCTGCTATGAAGATTACGGAATATGCTGAAGATATGAGGGGAGGAGACAGGCTTCAAGTCGTTGGCCGTAAGAATATCCCGTTATTTAAGTAGCATTATATGTGAACAGGTTCTTCTCCATTCTCTTGTTGTTCTGATTCCTGTAGTGGCAAATGTTAAAAGATGTCTACAATGTGTTTGATGAAAGTCTCATCTGAAACTGTCACGCCCCGAGCCTACACCCTGGGCGGGACCGGCTCTCGGAGACCATTGCTGGCCCCAAGCGAACCCTTGGCCTGGCTTTCTTAACTCAGCGGAAATCTAACTCAACAGAATAACTTCATGCAATGCAAAGTCATAAGACAACTTAACTGATACAAATCTGGCCAAAAAGGCACCTCGGGTCTCAAAATAGAATATTTACATATATACATAGATAAGAGACTCAAAACTAACTGATTGACTGTCTATGAAGCCTCTAATACTGCGATGGATGTTGGGACAGACCCCGCAACACCCTAA


Protein sequences

Name Description Sequence
Stu.3614 translated coding region predicted by ESTScan from UniGene Stu.3614

MGEEDTFENLKYLKLEQVTLSKWEVGEESFPALEKLKLWGCRKLEEIPPSFGDINSLKIIKLVKSPQLEDSAMKITEYAEDMRGGDRLQVVGRKNIPLFK

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.80.10.10
8-70 no description

ENLKYLKLEQVTLSKWEVGEESFPALEKLKLWGCRKLEEIPPSFGDINSLKIIKLVKSPQLED






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox