PRGDB00077171 (Stu.3665)

From PRG Wiki
Jump to: navigation, search
Stu.3665
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 39815039 (CK258059)
Gene Class Unknown
Domain Type LRR
Gene Species Solanum tuberosum

Comment?

EST741696 potato callus cDNA library, normalized and full-length Solanum tuberosum cDNA clone POCDA28 5' end, mRNA sequence

DNA Sequence

GATTGCTTGATTTGCGATCATGTGAAAATCTTGTAAGACTCCCAGCCAGTGTCTGTGAGATGAGAAAACTGAAAATTTTGATTCTGAAAGGCTGCTCAAGACTTGCAATTTTTCCTGAAAATCTAGGTGATCTAAACCAGTTAGAGGAGCTCTATGCTGGCAACACTTCCATTTTGCAACTACCAGATTCTGTTGGAAACTTGAGCAAACTGAAGATCCTATCATTAAGAAAAGGGTGGAAGGTTAAGCGTCAATGTGCTCGCAGTTTGATATTACCCAGGATGTTTCATGGTTTGAGGGAACTGAAAAGCTTAGATCTCAGTGGATGTAATTTATGTGATAACCAAGCTGCTGCTCTTATGAACGTAACTTCTTTATTGGAACTGAACCTGAGCAGAAATAAGTTTATTTATTTGCCCGATATCTCCGGCCGACTTTCTCACCTTCGATATCTCAATATTACACACTGTCAGGAACTTAAAGAACTGCCCAAACTTCCTAAGAGTATAGAGGAATTATATGTAGAAGATTTTTTGGCAAAAGAAAGTATTGCAAACCTACGGATGTACCCAAGGTTGAATTTGGTATCATTCACCAATTATAGTTTTGATCAACAATCTTATACAGAGGAGAGCAATGGTAGCTCAATTTCGGATGAGATTCTCAGTTTGTTTCTATCAAACAATATGGATGATGTGATCTTCCCCTCTCTTAACTCTGATCATAGGGTAACTTGTTCCATTGTCTTTCCTGAACGTGCAATCCCCACGTGGTTTATGCATCAGAGTGTCGAGGAAAAGATCTTGTTCAAACTGCCCATTAATTGGTATAATGATAAGTTCAAGGGCTTTGCTATATGCTGTGTGACTCGCATGGGGGGCAGGTGTCTGCAGTCCTGATTCAGGACTATCTGAGAAGTATGACTATGCTTTCATCAAAGCCAAATTGATATGGCATGATCATTTGAAA


Protein sequences

Name Description Sequence
Stu.3665 translated coding region predicted by ESTScan from UniGene Stu.3665

XLLDLRSCENLVRLPASVCEMRKLKILILKGCSRLAIFPENLGDLNQLEELYAGNTSILQLPDSVGNLSKLKILSLRKGWKVKRQCARSLILPRMFHGLRELKSLDLSGCNLCDNQAAALMNVTSLLELNLSRNKFIYLPDISGRLSHLRYLNITHCQELKELPKLPKSIEELYVEDFLAKESIANLRMYPRLNLVSFTNYSFDQQSYTEESNGSSISDEILSLFLSNNMDDVIFPSLNSDHRVTCSIVFPERAIPTWFMHQSVEEKILFKLPINWYNDKFKGFAICCVTPWGAGVCSPDSGLSEKYDYAFIKAKLIWHDHLK


Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.80.10.10
3-173 no description

LDLRSCENLVRLPASVCEMRKLKILILKGCSRLAIFPENLGDLNQLEELYAGNTSILQLPDSVGNLSKLKILSLRKGWKVKRQCARSLILPRMFHGLRELKSLDLSGCNLCDNQAAALMNVTSLLELNLSRNKFIYLPDISGRLSHLRYLNITHCQELKELPKLPKSIEEL

HMMPanther: PTHR23155
3-283 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LDLRSCENLVRLPASVCEMRKLKILILKGCSRLAIFPENLGDLNQLEELYAGNTSILQLPDSVGNLSKLKILSLRKGWKVKRQCARSLILPRMFHGLRELKSLDLSGCNLCDNQAAALMNVTSLLELNLSRNKFIYLPDISGRLSHLRYLNITHCQELKELPKLPKSIEELYVEDFLAKESIANLRMYPRLNLVSFTNYSFDQQSYTEESNGSSISDEILSLFLSNNMDDVIFPSLNSDHRVTCSIVFPERAIPTWFMHQSVEEKILFKLPINWYNDKFKG

superfamily: SSF52058
3-203 L domain-like,LRR

LDLRSCENLVRLPASVCEMRKLKILILKGCSRLAIFPENLGDLNQLEELYAGNTSILQLPDSVGNLSKLKILSLRKGWKVKRQCARSLILPRMFHGLRELKSLDLSGCNLCDNQAAALMNVTSLLELNLSRNKFIYLPDISGRLSHLRYLNITHCQELKELPKLPKSIEELYVEDFLAKESIANLRMYPRLNLVSFTNYSF

HMMPfam: PF00560
IPR001611
102-114 LRR_1
Leucine-rich repeat

LKSLDLSGCNLCD

HMMPfam: PF00560
IPR001611
148-166 LRR_1
Leucine-rich repeat

HLRYLNITHCQELKELPKL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox