PRGDB00077172 (Stu.3843)

From PRG Wiki
Jump to: navigation, search
Stu.3843
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 39827893 (CK270915)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Solanum tuberosum

Comment?

EST716993 potato abiotic stress cDNA library Solanum tuberosum cDNA clone POACW08 5' end, mRNA sequence

DNA Sequence

GTACCGTTTATCGCGGTACCTATGACAATCAAGATGTTGCAGTGAAACTGTTGGACTGGGGAGAGGATGGCATGGCCACAGCTGCTGAAACTGCTTCTCTGCGGGCATCATTTCGGCAGGAGGTTGCTGTTTGGCACAAACTTGACAATCCGAATGTTACCAGATTCGTTGGTGCTTCTATGGGTACTTCAAATCTTAAGATTCCTTCGAAGAATCCTTCTGATGGTTACACTACCCTTCCTTCTCGAGCTTGTTGTGTTCTTGTGGAATTTCTCCATGGCGGAACATTGAAAAATTACTTGTACAAAAACAGGAAGAAGAAGCTTGCCTTTAAGATTGTCCATCAGCTTGCTCTTGATTTGGCCAGAGGGCTGAGCTATTTGCACTCAAAAAAGATTGTACATCGTGATGTGAAAGCTGAAAACATGTTGTTAGACACTAGTAGAAATTTAAAAATTGCTGATTTTGGAGTTGCTCGTGTTGAAGCACAAAATCCCAAAGACATGACCGGGGAAACTGGAACCCTTGGCTACATGGCCCCAGAGGTACTTGATGGCAAGCCCTACAACAGAAAATGTGATGTATATAGCTTTGGTATTTGCTTATGGGAAATTTATTGCTGTGATCTCCCATATCTAGATCTAAGCTTCGCTGAAGTCTCTTCTGCCGTTGTTAGACAGAATTTGCGACCAAGTATCCCAAAATGTTGTCCAAGCTCTGTATCAAATATCATGAAGAAATGCTGGGACGCAAATCCAGACAAACGACCTGAAATGGATGAGGTAGTGAAAATGTTGGAAGCCATTGACACAAACAAAGGAGGAGGAATGATACCCGAAGACCAAGTTATACAAGGCTGTTTCTGCATTGTTCGTAGGAAACTCCGATGTTTCTAATCCACTGGCCCGATTAAACCCTGATGTGCCAGAGAAGCCCAGTATGGGGATTCTAGCGCTCCCTATCGAAG


Protein sequences

Name Description Sequence
Stu.3843 translated coding region predicted by ESTScan from UniGene Stu.3843

XTVYRGTYDNQDVAVKLLDWGEDGMATAAETASLRASFRQEVAVWHKLDNPNVTRFVGASMGTSNLKIPSKNPSDGYTTLPSRACCVLVEFLHGGTLKNYLYKNRKKKLAFKIVHQLALDLARGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDLPYLDLSFAEVSSAVVRQNLRPSIPKCCPSSVSNIMKKCWDANPDKRPEMDEVVKMLEAIDTNKGGGMNPKTKLYKAVSALFVGNSDVSNPLARLNPDVPEKPSMGILALPIEX

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-269 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XTVYRGTYDNQDVAVKLLDWGEDGMATAAETASLRASFRQEVAVWHKLDNPNVTRFVGASMGTSNLKIPSKNPSDGYTTLPSRACCVLVEFLHGGTLKNYLYKNRKKKLAFKIVHQLALDLARGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDLPYLDLSFAEVSSAVVRQNLRPSIPKCCPSSVSNIMKKCWDANPDKRPEMDEVVKMLEAI

Gene3D: G3DSA:3.30.200.20
2-50 no description

TVYRGTYDNQDVAVKLLDWGEDGMATAAETASLRASFRQEVAVWHKLDN

superfamily: SSF56112
IPR011009
2-274 Protein kinase-like (PK-like)
Protein kinase-like domain

TVYRGTYDNQDVAVKLLDWGEDGMATAAETASLRASFRQEVAVWHKLDNPNVTRFVGASMGTSNLKIPSKNPSDGYTTLPSRACCVLVEFLHGGTLKNYLYKNRKKKLAFKIVHQLALDLARGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDLPYLDLSFAEVSSAVVRQNLRPSIPKCCPSSVSNIMKKCWDANPDKRPEMDEVVKMLEAIDTNKG

HMMPanther: PTHR23257:SF276
2-279 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

TVYRGTYDNQDVAVKLLDWGEDGMATAAETASLRASFRQEVAVWHKLDNPNVTRFVGASMGTSNLKIPSKNPSDGYTTLPSRACCVLVEFLHGGTLKNYLYKNRKKKLAFKIVHQLALDLARGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDLPYLDLSFAEVSSAVVRQNLRPSIPKCCPSSVSNIMKKCWDANPDKRPEMDEVVKMLEAIDTNKGGGMNP

HMMPanther: PTHR23257
2-279 FAMILY NOT NAMED,Ser-thr,SERINE-THREONINE PROTEIN KINASE

TVYRGTYDNQDVAVKLLDWGEDGMATAAETASLRASFRQEVAVWHKLDNPNVTRFVGASMGTSNLKIPSKNPSDGYTTLPSRACCVLVEFLHGGTLKNYLYKNRKKKLAFKIVHQLALDLARGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDLPYLDLSFAEVSSAVVRQNLRPSIPKCCPSSVSNIMKKCWDANPDKRPEMDEVVKMLEAIDTNKGGGMNP

HMMSmart: SM00219
IPR020635
2-266 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

TVYRGTYDNQDVAVKLLDWGEDGMATAAETASLRASFRQEVAVWHKLDNPNVTRFVGASMGTSNLKIPSKNPSDGYTTLPSRACCVLVEFLHGGTLKNYLYKNRKKKLAFKIVHQLALDLARGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDLPYLDLSFAEVSSAVVRQNLRPSIPKCCPSSVSNIMKKCWDANPDKRPEMDEVVKML

HMMSmart: SM00220
IPR002290
2-269 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

TVYRGTYDNQDVAVKLLDWGEDGMATAAETASLRASFRQEVAVWHKLDNPNVTRFVGASMGTSNLKIPSKNPSDGYTTLPSRACCVLVEFLHGGTLKNYLYKNRKKKLAFKIVHQLALDLARGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDLPYLDLSFAEVSSAVVRQNLRPSIPKCCPSSVSNIMKKCWDANPDKRPEMDEVVKMLEAI

HMMPfam: PF07714
IPR001245
3-266 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

VYRGTYDNQDVAVKLLDWGEDGMATAAETASLRASFRQEVAVWHKLDNPNVTRFVGASMGTSNLKIPSKNPSDGYTTLPSRACCVLVEFLHGGTLKNYLYKNRKKKLAFKIVHQLALDLARGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDLPYLDLSFAEVSSAVVRQNLRPSIPKCCPSSVSNIMKKCWDANPDKRPEMDEVVKML

Gene3D: G3DSA:1.10.510.10
51-271 no description

PNVTRFVGASMGTSNLKIPSKNPSDGYTTLPSRACCVLVEFLHGGTLKNYLYKNRKKKLAFKIVHQLALDLARGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDLPYLDLSFAEVSSAVVRQNLRPSIPKCCPSSVSNIMKKCWDANPDKRPEMDEVVKMLEAIDT

FPrintScan: PR00109
IPR001245
89-102 TYRKINASE
Serine-threonine/tyrosine-protein kinase

VEFLHGGTLKNYLY

Seg: seg
97-109 seg

LKNYLYKNRKKKL

FPrintScan: PR00109
IPR001245
127-145 TYRKINASE
Serine-threonine/tyrosine-protein kinase

YLHSKKIVHRDVKAENMLL

PatternScan: PS00108
IPR008271
133-145 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDVKAENMLL

FPrintScan: PR00109
IPR001245
193-215 TYRKINASE
Serine-threonine/tyrosine-protein kinase

CDVYSFGICLWEIYCCDLPYLDL

FPrintScan: PR00109
IPR001245
237-259 TYRKINASE
Serine-threonine/tyrosine-protein kinase

CPSSVSNIMKKCWDANPDKRPEM






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox