PRGDB00077173 (Stu.3901)

From PRG Wiki
Jump to: navigation, search
Stu.3901
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 53779946 (CV497589)
Gene Class Unknown
Domain Type LRR
Gene Species Solanum tuberosum

Comment?

61803.1 Mixed Leaf Solanum tuberosum cDNA clone 61803 5', mRNA sequence

DNA Sequence

ctactttcctcttcatttcttccttcttcttctccaaaaaaatccctagaaaattctccATCAAATTCTAAGCAAAACCCATCAATTTTCTTTGCTTTCTGAGTATTATTAACCATGGCAGCTGTGTTCAAAACCCAGAGTTCGTTCTTGAAGTTATGGGGTTTGTTGGCAGTTGTGCTTGCTGTAGCTGTGGCTGTGAAGGGGAATTCAGAAGGGGATGCTTTGTACGCCCTCCGCCGGAGCTTATCCGACCCGGGTAACGTGCTTCAGAGCTGGGATCCGAATCTTGTTAACCCTTGTACCTGGTTTCATGTCACTTGCAACGGAGATAATCAAGTCACTCGTGTGGACCTTGGCAACTCAAAGTTATCTGGTCATTTGGTACCTGAGCTTGGAAAGCTTGATCATCTACAGTATCTGGAGCTTTACAAAAATAATATTCAGGGAACCATCCCTAAAGAGCTCGGTAACTTGAAGAGCCTTATTAGTCTGGATCTGTACAACAACAATATTTCGGGGACAATTCCTACTTCACTTGGAAAGCTGAAAAACCTTGTTTTCTTGCGTCTAAATGATAACAAGCTAACAGGACCAATCCCAAGAGAACTTACTAGCGTTTCTAGCCTGAAAGTTGTGGATGTCTCGAATAATGATTTTGTGTGGAACAATTCCCACTTCTGGTCCATTTGAGCATTTTCCTCTGAACAAATTCCGAGCACAAATCCTCGACTTGAAAGGGTCCGGAGTTGTTGGGGACTCGCTACTACGAGCACCAAAGTTGCTCCTTTAAGAGGGCTTGACGGAATTAGCTTTCGGAAAGGAAAGCACCACCAACTTTTTGTGGGGAAAGTTTTAACGAAAATTTCCCCTCCCCTGGGAACCTGTTTATTCGTTGGTCACTCAACCAGGGTGTCACAAGTTTGTTTGACTCTTAGCCCCAGGGTATAGGGTGATGGTGGTATACCTCACGTGAAGGAGATGTGTTTAACCAAATCTCTTATGTTCCCACT


Protein sequences

Name Description Sequence
Stu.3901 translated coding region predicted by ESTScan from UniGene Stu.3901

MAAVFKTQSSFLKLWGLLAVVLAVAVAVKGNSEGDALYALRRSLSDPGNVLQSWDPNLVNPCTWFHVTCNGDNQVTRVDLGNSKLSGHLVPELGKLDHLQYLELYKNNIQGTIPKELGNLKSLISLDLYNNNISGTIPTSLGKLKNLVFLRLNDNKLTGPIPRELTSVSSLKVVDVSNNDFVWNNSHFWSIXAFSSEQIPSTNPRLERVRSCWGLATTSTKVAPLRGLDGISFRKGKHHQLFVGKVLTKISPPLGTCLFVGHSTRVSQVCLTLSPRVXGDGGIPHVKEMCLTKSLMFPL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF836
17-180 SUBFAMILY NOT NAMED

LLAVVLAVAVAVKGNSEGDALYALRRSLSDPGNVLQSWDPNLVNPCTWFHVTCNGDNQVTRVDLGNSKLSGHLVPELGKLDHLQYLELYKNNIQGTIPKELGNLKSLISLDLYNNNISGTIPTSLGKLKNLVFLRLNDNKLTGPIPRELTSVSSLKVVDVSNND

HMMPanther: PTHR24420
17-180 FAMILY NOT NAMED,FAMILY NOT NAMED

LLAVVLAVAVAVKGNSEGDALYALRRSLSDPGNVLQSWDPNLVNPCTWFHVTCNGDNQVTRVDLGNSKLSGHLVPELGKLDHLQYLELYKNNIQGTIPKELGNLKSLISLDLYNNNISGTIPTSLGKLKNLVFLRLNDNKLTGPIPRELTSVSSLKVVDVSNND

Seg: seg
17-28 seg

LLAVVLAVAVAV

superfamily: SSF52058
27-181 L domain-like,LRR

AVKGNSEGDALYALRRSLSDPGNVLQSWDPNLVNPCTWFHVTCNGDNQVTRVDLGNSKLSGHLVPELGKLDHLQYLELYKNNIQGTIPKELGNLKSLISLDLYNNNISGTIPTSLGKLKNLVFLRLNDNKLTGPIPRELTSVSSLKVVDVSNNDF

HMMPfam: PF08263
IPR013210
31-70 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

NSEGDALYALRRSLSDPGNVLQSWDPNLVNPCTWFHVTCN

Gene3D: G3DSA:3.80.10.10
32-182 no description

SEGDALYALRRSLSDPGNVLQSWDPNLVNPCTWFHVTCNGDNQVTRVDLGNSKLSGHLVPELGKLDHLQYLELYKNNIQGTIPKELGNLKSLISLDLYNNNISGTIPTSLGKLKNLVFLRLNDNKLTGPIPRELTSVSSLKVVDVSNNDFV

HMMPfam: PF12799
98-134 LRR_4,Leucine Rich repeats (2 copies)

HLQYLELYKNNIQGTIPKELGNLKSLISLDLYNNNIS

HMMPfam: PF13516
144-164 LRR_6,Leucine Rich repeat

LKNLVFLRLNDNKLTGPIPRE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox