PRGDB00077175 (Stu.4075)

From PRG Wiki
Jump to: navigation, search
Stu.4075
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 62950152 (DN939893)
Gene Class Unknown
Domain Type
Gene Species Solanum tuberosum

Comment?

7585.3 After-Cooking Darkening A Solanum tuberosum cDNA clone 7585 3', mRNA sequence

DNA Sequence

ttttttttGCCATAGTGCACAAGCTGTATATGATCAGTTAATAGTACAACAGAAGATAATTTCACACTTTTTGAGTATTGGTAGATACAACGAGCTTAAACAAAACATATGAATTACAAAATAAATAGTGAGTAAAAGAATAAGGCAGGCAGTACGAGGTAGgaaaaggaaaaatggaaagaaaaaaaaaaGTGACTTGTGCTCTCTGTTAAAGAACATTGCCTTGGCGTGTATTTGCTGCTTTCAAGACATGAGGAGATTTTAACGTCCTTTTGGATTCATGATTTGAGAGACAACAGCACTAGGTGTTAGCCCATCTGAGTCTTCGCTGGCAAGGCTGCGGCCGCCAATGCTCATAGATATGCCGCTGCTTCTTGAATCAGTCATGCTTGCATCATAACCTGGGGATTCATTTAAATCCTTCTTTCCTTTGCATGTAACATCATCAAACCCTTCTTCAATGTCCATTTTCCCAAAACCCTTCCCACACTCCTCTGCACTCTCCTGAAGTTGCAGAGCAAACTCAAGGTTCCACAGCACATCTCCCATCGACGGCCTGTCTACACCAACATCAGACACACACTTCACTGCTGTTTCTGTAAATTTCTTCAAGCACTCTGGTGCAAGCTTCCCTTTCAGATATGGGTCGATTATCTGGTCAAAAGTCCCCTTCTTGTAGCAATGGAAAGCCCACTCTGCCAAGCTTACTTGCTCCTTTGGAAGAGTTGGGTTCAGAGCTGGCCNGAGCACACAAAATCTCAAACAGCACTACACCAAATTGAGTAGACATCAAGATTTGTCTGTCAGTTGCTGCCTTCTGAAGTATTCCTGGGATCCCGATATCCAAAATGCCTTTCAACACCGTACTGAACCATTGGTGTGATCCACTTTGGACCTGTTTTAAACAAACCAAATCGAAAACTTTGCCCCCCCTTTTTCTTCCCAAAGATATATTGGCTCACCACACGAGGAAAATAATGCCTGGCCCGTTGAAAGTGACCCGGACGGTCCATAATTCACCCTGTTTGAAGAGGAACTCAGTTCTGATGTGCCCAAGAGCACACCGTCTTATATAAATCGTTCTCAC


Protein sequences

Name Description Sequence
Stu.4075 translated coding region predicted by ESTScan from UniGene Stu.4075

VRTIYIRRCALGHIRTEFLFKQGELWTVRVTFNGPGIIFLVWXANISLGRKRGGKVFDLVCLKQVQSGSHQWFSTVLKGILDIGIPGILQKAATDRQILMSTQFGVVLFEILCAXASSEPNSSKGARSLAEWAFHCYKKGTFDQIIDPYLKGKLAPECLKKFTETAVKCVSDVGVDRPSMGDVLWNLEFALQLQESAEECGKGFGKMDIEEGFDDVTCKGKKDLNESPGYDASMTDSRSSGISMSIGGRSLASEDSDGLTPSAVVSQIMNPKGR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF418
104-256 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

FGVVLFEILCAXASSEPNSSKGARSLAEWAFHCYKKGTFDQIIDPYLKGKLAPECLKKFTETAVKCVSDVGVDRPSMGDVLWNLEFALQLQESAEECGKGFGKMDIEEGFDDVTCKGKKDLNESPGYDASMTDSRSSGISMSIGGRSLASEDS

HMMPanther: PTHR24420
104-256 FAMILY NOT NAMED,FAMILY NOT NAMED

FGVVLFEILCAXASSEPNSSKGARSLAEWAFHCYKKGTFDQIIDPYLKGKLAPECLKKFTETAVKCVSDVGVDRPSMGDVLWNLEFALQLQESAEECGKGFGKMDIEEGFDDVTCKGKKDLNESPGYDASMTDSRSSGISMSIGGRSLASEDS

Seg: seg
237-250 seg

SRSSGISMSIGGRS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox