PRGDB00077176 (Stu.4146)

From PRG Wiki
Jump to: navigation, search
Stu.4146
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 21921450 (BQ505517)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Solanum tuberosum

Comment?

EST612932 Generation of a set of potato cDNA clones for microarray analyses mixed potato tissues Solanum tuberosum cDNA clone STMGE57 3' end, mRNA sequence

DNA Sequence

TAATGACACTTTTGAATCAGGAATGTATCATCAACTAGTGAATGTCAATCCAAGTGGTATAAAAGCAAATCTCCTACATACAAACAGCTAAACCTAGAAAAACAAGAAAAGTAGAAAGCCCTTGAGACTTTACAAGAACTGAATCAACAAATCCCTGAGAACTCAGATACATCGATGATGCTTAACTTACGAAGTAACTTCTGCCTTCCAAAAGAATCAAGACACGTTATTCGGGGCCTCCATAAGTATAGTACAAACTCATATGCTCAAATGTTCATCTCTTGGCAAGCTTTGGACAGTATCTGACCATCTTCCTGGTGAATGGTCACTGCTATTGGAGGACCCTTGAGCTTCTGCTCTAGCATCCCGGATCATCTTCAAAACATCCTTCATTGTGGGTCGATTCTCTGGTACAAGTGAAACACAAGCCATAGCTACGTTTAAGAGAGCACCGAGTTTCTCTTCCGAGGCTTCATTACTGGAAGCAGGTTCATCACCTGATTCAGTTTCTTCTTCTCGAACAGATTTCACCCACCTCGGTATGTCTGATCCGTGTTCTTGAACAAGATCTTGAAATGGAGTCTTTCCCGTGAGGAGCTCCAATAGGAGGACACCAAAGCTATAGACATCGGCCTGAATGGGTAAGTGGCCTTCGAATGTCACGACACTCAGGAGCTCTATAGAAGAGGGAAGAAGCACCTGATTCCTCAGGAGAATCTAGATTCCTAAATGGCATGAGGCCATAATCTGTAAGACACGACTCAAAGTCGGCCCCCAAGAGTACATTTGATGATTTCAAGTTTCCATGAGTCAGACCAGGGTTCTGATGGATATGAAGCAATCCAGTAGCCACATCCTCGGCCATTTTGAGACAGGAAGTCCAGTGAAGAGGCTTTGAACACTATTAGCTCTTGTCCCATGAACGAGGGGAG


Protein sequences

Name Description Sequence
Stu.4146 translated coding region predicted by ESTScan from UniGene Stu.4146

XSPRSWDKSXXCSKPLHWTSCLKMAEDVATGLLHIHQNPGLTHGNLKSSNVLLGADFESCLTDYGLMPFRNLDSPEESGASSLFYRAPECRDIEGHLPIQADVYSFGVLLLELLTGKTPFQDLVQEHGSDIPRWVKSVREEETESGDEPASSNEASEEKLGALLNVAMACVSLVPENRPTMKDVLKMIRDARAEAQGSSNSSDHSPGRWSDTVQSLPRDEHLSI

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-193 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XSPRSWDKSXXCSKPLHWTSCLKMAEDVATGLLHIHQNPGLTHGNLKSSNVLLGADFESCLTDYGLMPFRNLDSPEESGASSLFYRAPECRDIEGHLPIQADVYSFGVLLLELLTGKTPFQDLVQEHGSDIPRWVKSVREEETESGDEPASSNEASEEKLGALLNVAMACVSLVPENRPTMKDVLKMIRDARA

HMMSmart: SM00220
IPR002290
4-188 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

RSWDKSXXCSKPLHWTSCLKMAEDVATGLLHIHQNPGLTHGNLKSSNVLLGADFESCLTDYGLMPFRNLDSPEESGASSLFYRAPECRDIEGHLPIQADVYSFGVLLLELLTGKTPFQDLVQEHGSDIPRWVKSVREEETESGDEPASSNEASEEKLGALLNVAMACVSLVPENRPTMKDVLKMI

Gene3D: G3DSA:1.10.510.10
12-202 no description

CSKPLHWTSCLKMAEDVATGLLHIHQNPGLTHGNLKSSNVLLGADFESCLTDYGLMPFRNLDSPEESGASSLFYRAPECRDIEGHLPIQADVYSFGVLLLELLTGKTPFQDLVQEHGSDIPRWVKSVREEETESGDEPASSNEASEEKLGALLNVAMACVSLVPENRPTMKDVLKMIRDARAEAQGSSNSS

HMMPfam: PF00069
IPR017442
13-186 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

SKPLHWTSCLKMAEDVATGLLHIHQNPGLTHGNLKSSNVLLGADFESCLTDYGLMPFRNLDSPEESGASSLFYRAPECRDIEGHLPIQADVYSFGVLLLELLTGKTPFQDLVQEHGSDIPRWVKSVREEETESGDEPASSNEASEEKLGALLNVAMACVSLVPENRPTMKDVLK

superfamily: SSF56112
IPR011009
15-188 Protein kinase-like (PK-like)
Protein kinase-like domain

PLHWTSCLKMAEDVATGLLHIHQNPGLTHGNLKSSNVLLGADFESCLTDYGLMPFRNLDSPEESGASSLFYRAPECRDIEGHLPIQADVYSFGVLLLELLTGKTPFQDLVQEHGSDIPRWVKSVREEETESGDEPASSNEASEEKLGALLNVAMACVSLVPENRPTMKDVLKMI

HMMPanther: PTHR24420:SF779
15-206 SUBFAMILY NOT NAMED

PLHWTSCLKMAEDVATGLLHIHQNPGLTHGNLKSSNVLLGADFESCLTDYGLMPFRNLDSPEESGASSLFYRAPECRDIEGHLPIQADVYSFGVLLLELLTGKTPFQDLVQEHGSDIPRWVKSVREEETESGDEPASSNEASEEKLGALLNVAMACVSLVPENRPTMKDVLKMIRDARAEAQGSSNSSDHSP

HMMPanther: PTHR24420
15-206 FAMILY NOT NAMED,FAMILY NOT NAMED

PLHWTSCLKMAEDVATGLLHIHQNPGLTHGNLKSSNVLLGADFESCLTDYGLMPFRNLDSPEESGASSLFYRAPECRDIEGHLPIQADVYSFGVLLLELLTGKTPFQDLVQEHGSDIPRWVKSVREEETESGDEPASSNEASEEKLGALLNVAMACVSLVPENRPTMKDVLKMIRDARAEAQGSSNSSDHSP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox