PRGDB00077177 (Stu.4279)

From PRG Wiki
Jump to: navigation, search
Stu.4279
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 39826231 (CK269253)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Solanum tuberosum

Comment?

EST715331 potato abiotic stress cDNA library Solanum tuberosum cDNA clone POACL71 5' end, mRNA sequence

DNA Sequence

TTCAGTTCACAGATCAAAACCCTCCACACTTTCAAGAAGATTTTGTTGATTGAGCTATGAGCTGCTTCAGTTGTTGTGATGATGATGATATGCACAGAGCTTCTGATAATGGGCCATTCATGGCACACAATTCAGCAGGCAACAATGGAGGTCAGCATGCCACAGAAAGTGCACAAAGAGAGACACAGACTGTGAATATCCAGCCCATTGCTGTTCCTTCCATTGCTGTTGATGAGTTAAAGGATATCACTGACAACTTTGGTTCAAAAGCATTGATAGGCGAGGGATCATATGGAAGGGTATACCATGGTGTCTTGAAAAGTGGACGTGCTGCAGCCATTAAAAAATTAGACTCGAGTAAGCAGCCTGATCGAGAATTTTTAGCTCAGGTCTCAATGGTCTCAAGACTAAAAGATGATAATGTGGTTGAATTACTCGGTTATTGTGTGGATGGCGGTTTTCGTGTGCTAGCCTATGAGTATGCCCCGAATGGATCTCTTCATGACATCCTTCATGGAAGAAAAGGTGTGAAAGGTGCACAGCCAGGTCCAGTATTGTCATGGGCTCAACGAGTTAAAATTGCGGTTGGGGCTGCAAAAGGACTGGAGTACTTGCATGAAAAAGCGCAGCCTCATATCATTCATCGTGATATTAAGTCTAGCAACATTTTACTCTTTGATGATGATGTTGCTAAGATCGCAGATTTTGATTTATCAAATCAAGCCCCTGATATGGCAGCACGTCTTCATTCCACCCGTGTTCTTGGGACCTTTGGTTATCATGCACCAGAATATGCAATGACTGGTCAGTTGAGTTCAAAGAGTGATGTTTATAGCTTTGGCGTTGTGCTCCTGGAACTACTTACTGGCCGTAAACCTGTTGATCATACTTTGCCACGTGGGCAACAGAGTCTTGTAACCTGGGCAACCCCAAGACTTAGTGAAGATAAAGTGAAGCAGTGTGTTGATGCTAGATTAATACAGATTACCCTC


Protein sequences

Name Description Sequence
Stu.4279 translated coding region predicted by ESTScan from UniGene Stu.4279

XQFTDQNPPHFQEDFVDXAMSCFSCCDDDDMHRASDNGPFMAHNSAGNNGGQHATESAQRETQTVNIQPIAVPSIAVDELKDITDNFGSKALIGEGSYGRVYHGVLKSGRAAAIKKLDSSKQPDREFLAQVSMVSRLKDDNVVELLGYCVDGGFRVLAYEYAPNGSLHDILHGRKGVKGAQPGPVLSWAQRVKIAVGAAKGLEYLHEKAQPHIIHRDIKSSNILLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPRLSEDKVKQCVDARLIQITL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF870
20-326 SUBFAMILY NOT NAMED

MSCFSCCDDDDMHRASDNGPFMAHNSAGNNGGQHATESAQRETQTVNIQPIAVPSIAVDELKDITDNFGSKALIGEGSYGRVYHGVLKSGRAAAIKKLDSSKQPDREFLAQVSMVSRLKDDNVVELLGYCVDGGFRVLAYEYAPNGSLHDILHGRKGVKGAQPGPVLSWAQRVKIAVGAAKGLEYLHEKAQPHIIHRDIKSSNILLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPRLSEDKVKQCVDARL

HMMPanther: PTHR24420
20-326 FAMILY NOT NAMED,FAMILY NOT NAMED

MSCFSCCDDDDMHRASDNGPFMAHNSAGNNGGQHATESAQRETQTVNIQPIAVPSIAVDELKDITDNFGSKALIGEGSYGRVYHGVLKSGRAAAIKKLDSSKQPDREFLAQVSMVSRLKDDNVVELLGYCVDGGFRVLAYEYAPNGSLHDILHGRKGVKGAQPGPVLSWAQRVKIAVGAAKGLEYLHEKAQPHIIHRDIKSSNILLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPRLSEDKVKQCVDARL

Seg: seg
25-30 seg

CCDDDD

superfamily: SSF56112
IPR011009
57-327 Protein kinase-like (PK-like)
Protein kinase-like domain

SAQRETQTVNIQPIAVPSIAVDELKDITDNFGSKALIGEGSYGRVYHGVLKSGRAAAIKKLDSSKQPDREFLAQVSMVSRLKDDNVVELLGYCVDGGFRVLAYEYAPNGSLHDILHGRKGVKGAQPGPVLSWAQRVKIAVGAAKGLEYLHEKAQPHIIHRDIKSSNILLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPRLSEDKVKQCVDARLI

Gene3D: G3DSA:3.30.200.20
72-147 no description

VPSIAVDELKDITDNFGSKALIGEGSYGRVYHGVLKSGRAAAIKKLDSSKQPDREFLAQVSMVSRLKDDNVVELLG

ProfileScan: PS50011
IPR000719
87-331 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FGSKALIGEGSYGRVYHGVLKSGRAAAIKKLDSSKQPDREFLAQVSMVSRLKDDNVVELLGYCVDGGFRVLAYEYAPNGSLHDILHGRKGVKGAQPGPVLSWAQRVKIAVGAAKGLEYLHEKAQPHIIHRDIKSSNILLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPRLSEDKVKQCVDARLIQITL

HMMSmart: SM00219
IPR020635
87-331 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FGSKALIGEGSYGRVYHGVLKSGRAAAIKKLDSSKQPDREFLAQVSMVSRLKDDNVVELLGYCVDGGFRVLAYEYAPNGSLHDILHGRKGVKGAQPGPVLSWAQRVKIAVGAAKGLEYLHEKAQPHIIHRDIKSSNILLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPRLSEDKVKQCVDARLIQITL

HMMSmart: SM00220
IPR002290
87-327 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FGSKALIGEGSYGRVYHGVLKSGRAAAIKKLDSSKQPDREFLAQVSMVSRLKDDNVVELLGYCVDGGFRVLAYEYAPNGSLHDILHGRKGVKGAQPGPVLSWAQRVKIAVGAAKGLEYLHEKAQPHIIHRDIKSSNILLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPRLSEDKVKQCVDARLI

HMMPfam: PF07714
IPR001245
91-297 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

ALIGEGSYGRVYHGVLKSGRAAAIKKLDSSKQPDREFLAQVSMVSRLKDDNVVELLGYCVDGGFRVLAYEYAPNGSLHDILHGRKGVKGAQPGPVLSWAQRVKIAVGAAKGLEYLHEKAQPHIIHRDIKSSNILLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHT

PatternScan: PS00107
IPR017441
93-116 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGSYGRVYHGVLKSGRAAAIKK

Gene3D: G3DSA:1.10.510.10
148-307 no description

YCVDGGFRVLAYEYAPNGSLHDILHGRKGVKGAQPGPVLSWAQRVKIAVGAAKGLEYLHEKAQPHIIHRDIKSSNILLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVT

PatternScan: PS00108
IPR008271
213-225 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDIKSSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox