PRGDB00077178 (Stu.4375)

From PRG Wiki
Jump to: navigation, search
Stu.4375
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 39790959 (CK244915)
Gene Class Unknown
Domain Type LRR
Gene Species Solanum tuberosum

Comment?

EST728552 potato callus cDNA library, normalized and full-length Solanum tuberosum cDNA clone POCAA94 3' end, mRNA sequence

DNA Sequence

TCATTACTTACAAATTCAATACATAAAACAAGTAAATACAAGTCAACAGTGTTGTAAATTGGGCTACTTGTTGTCCCAATCTAACATACATTGCTATTATAATTATGAAAATTATAAATGGTGGATAAATCAGTGGTGAGGTTTCTTGAGGGCAGCATAAGTAGTCGAACGAGTCCTTGCATCGCCGGTGGTATGAGCTCGACCTGAAGAACTATTCCTAGAAGAGAAGTCATGAATCTTACAAGGTACATAGCTTAGTGATTTCATGTCCCGGCAATTTCTCTTTTGTAAAAAGAAAGTTTCGCATTCCTCCGGCTTTCTCTGGTTCTCAAGATCAATAATGCAATTCATGCCAATATCAAGTACTTTCTCCTCTACCAACTTCCGACATTCCGGTCCAATCTGTGTGAAATAGTTGTATTTCAAGGTGAGTTCCTCCAAGCTACTGATCTTGCACAATGTTTCCGGCACTTCCCCATACAATTGATTGTAAGACAGATCCATCACTTCCATTTGCTCAAGGCACCCGAAAGATTGCGGGATCGGACCTGTTAATTTATTCTTACTAGCATCAAATACAGATGCCAATTTCAACATGCCTATCTCATAAGGCAAGCAACCAGTAAGTTGATTATTGAAGAAGAGAACCTCAAGGAGGTTTCCCTTGGCATGACCAATGCTTTTGGGGATTTCACCAATGAATTTATTGTTGGCTAATGTAAGATACAGGGCAGCAGTACGGCCTAAATTTTCCGGGATTTTCCAGGAAAAACAATTGTTGTTGAGAAAAAGAATATCAAGGTCCAGTGTGAATACTTGAGGGTTTACTGGACCTTTTATCTGGTTGAATCTGAGATCCAAATAAGTTAACCTGGTGGCACCAAGAACAGCTTTTGG


Protein sequences

Name Description Sequence
Stu.4375 translated coding region predicted by ESTScan from UniGene Stu.4375

PKAVLGATRLTYLDLRFNQIKGPVNPQVFTLDLDILFLNNNCFSWKIPENLGRTAALYLTLANNKFIGEIPKSIGHAKGNLLEVLFFNNQLTGCLPYEIGMLKLASVFDASKNKLTGPIPQSFGCLEQMEVMDLSYNQLYGEVPETLCKISSLEELTLKYNYFTQIGPECRKLVEEKVLDIGMNCIIDLENQRKPEECETFFLQKRNCRDMKSLSYVPCKIHDFSSRNSSSGRAHTTGDARTRSTTYAALKKPHH

Domains

Domain Start-End Description Sequence

superfamily: SSF52058
1-187 L domain-like,LRR

PKAVLGATRLTYLDLRFNQIKGPVNPQVFTLDLDILFLNNNCFSWKIPENLGRTAALYLTLANNKFIGEIPKSIGHAKGNLLEVLFFNNQLTGCLPYEIGMLKLASVFDASKNKLTGPIPQSFGCLEQMEVMDLSYNQLYGEVPETLCKISSLEELTLKYNYFTQIGPECRKLVEEKVLDIGMNCII

HMMPanther: PTHR24420:SF937
1-196 SUBFAMILY NOT NAMED

PKAVLGATRLTYLDLRFNQIKGPVNPQVFTLDLDILFLNNNCFSWKIPENLGRTAALYLTLANNKFIGEIPKSIGHAKGNLLEVLFFNNQLTGCLPYEIGMLKLASVFDASKNKLTGPIPQSFGCLEQMEVMDLSYNQLYGEVPETLCKISSLEELTLKYNYFTQIGPECRKLVEEKVLDIGMNCIIDLENQRKPE

HMMPanther: PTHR24420
1-196 FAMILY NOT NAMED,FAMILY NOT NAMED

PKAVLGATRLTYLDLRFNQIKGPVNPQVFTLDLDILFLNNNCFSWKIPENLGRTAALYLTLANNKFIGEIPKSIGHAKGNLLEVLFFNNQLTGCLPYEIGMLKLASVFDASKNKLTGPIPQSFGCLEQMEVMDLSYNQLYGEVPETLCKISSLEELTLKYNYFTQIGPECRKLVEEKVLDIGMNCIIDLENQRKPE

Gene3D: G3DSA:3.80.10.10
1-186 no description

PKAVLGATRLTYLDLRFNQIKGPVNPQVFTLDLDILFLNNNCFSWKIPENLGRTAALYLTLANNKFIGEIPKSIGHAKGNLLEVLFFNNQLTGCLPYEIGMLKLASVFDASKNKLTGPIPQSFGCLEQMEVMDLSYNQLYGEVPETLCKISSLEELTLKYNYFTQIGPECRKLVEEKVLDIGMNCI

HMMPfam: PF13504
8-21 LRR_7,Leucine rich repeat

TRLTYLDLRFNQIK

HMMPfam: PF13504
151-166 LRR_7,Leucine rich repeat

SSLEELTLKYNYFTQI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox