PRGDB00077179 (Stu.4408)

From PRG Wiki
Jump to: navigation, search
Stu.4408
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 66835873 (DR033982)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Solanum tuberosum

Comment?

16182.3 Swollen Stolon Solanum tuberosum cDNA clone 16182 3', mRNA sequence

DNA Sequence

CGGGCCCCCTCCTTTTGTTGGAATGTGACATCATATGAAACTATGAAATATATATTATTTCTTTAATCCCGCTGTTAGAACAAATTAGAAGGAAGAGGAAAAGAACTGAAAATAAATTATGCACTATGAACAGATTTTAGCGTCTCGTTTTGGTACAATGCACTCCAAGTCTGCAAAACAACAGGCTCGAAGTCATTTCTCATGAATAGaaacaaaaacaaaaaaaaGACACCTCCACGTGTTAGAATAGGCAACATGCTGAGTACTCAACGTCACATGGAAACTATGGTTCATAGTCCGGGCCATCTGTTTCACCCCTTGAAGTACCCTGATCAGCACCAAATGTCCTCTTGCTCATGTTTGCTCGTTGCACTAGCCGAACTAATGCTTCAACCACTTCCGACATAGGTGGCCTGAACTCGGGCTCAGGCTGGACACAGAGAGCTATTACATCAGCAAAGCGTGATAGAGATTTAACAGGATAGAGCCCCTCGAGTGCTGGATCAACCATCTTAGCTAGGGCATCAATATCATGCAGCTGAGGTGTTGCCCATCTAACTAGAGATTGTTCAGATCTTGTTCTTGCGCTATCAAAAGGTTTTCGTCCGGTAAGAAGTTCCAACATAACCACTCCAAAGCTGTACACATCACTTTTTATGGTACAGAGTCCGGACATAGCAACTTCGGGGGCACCATATCCCGATCCTGTATTATGGTTCAATGCCTGATCTGCATCAGCAATTAGACTTGCCAATTCCACAGTCTGATAAGATGAGGATTGAGTTCTGCATCAAGTACAATATTTGCAGACTTGATATTTCTTGTGAACCAAAGATGGTTGAACAAACTTCGTGCCAGATAACTCTTATGTGCTCTTTGCTGTGCCATAGGTGGCAATCTTTAAACTCGGGCTAATTCCATTGTTAAGAGGCTTGCTTTTCCTCATCTGGACAGATTGCGGGGAAATCATTGCAGAGAACCCTCTTTGGGGGAATTCCATTAAACCCAGAAGATTCTTTGCCCGGCGTTCTTTGAAACAAT


Protein sequences

Name Description Sequence
Stu.4408 translated coding region predicted by ESTScan from UniGene Stu.4408

XCFKERRAKNLLGLMEFPQRGFSAMISPQSVQMRKSKPLNNGISPSLKIATYGTAKSTXELSGTKFVQPSLVHKKYQVCKYCTXCRTQSSSYQTVELASLIADADQALNHNTGSGYGAPEVAMSGLCTIKSDVYSFGVVMLELLTGRKPFDSARTRSEQSLVRWATPQLHDIDALAKMVDPALEGLYPVKSLSRFADVIALCVQPEPEFRPPMSEVVEALVRLVQRANMSKRTFGADQGTSRGETDGPDYEPXFPCDVEYSACCLF

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-223 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XCFKERRAKNLLGLMEFPQRGFSAMISPQSVQMRKSKPLNNGISPSLKIATYGTAKSTXELSGTKFVQPSLVHKKYQVCKYCTXCRTQSSSYQTVELASLIADADQALNHNTGSGYGAPEVAMSGLCTIKSDVYSFGVVMLELLTGRKPFDSARTRSEQSLVRWATPQLHDIDALAKMVDPALEGLYPVKSLSRFADVIALCVQPEPEFRPPMSEVVEALVRL

HMMPanther: PTHR24420:SF463
97-238 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

LASLIADADQALNHNTGSGYGAPEVAMSGLCTIKSDVYSFGVVMLELLTGRKPFDSARTRSEQSLVRWATPQLHDIDALAKMVDPALEGLYPVKSLSRFADVIALCVQPEPEFRPPMSEVVEALVRLVQRANMSKRTFGADQ

HMMPanther: PTHR24420
97-238 FAMILY NOT NAMED,FAMILY NOT NAMED

LASLIADADQALNHNTGSGYGAPEVAMSGLCTIKSDVYSFGVVMLELLTGRKPFDSARTRSEQSLVRWATPQLHDIDALAKMVDPALEGLYPVKSLSRFADVIALCVQPEPEFRPPMSEVVEALVRLVQRANMSKRTFGADQ

HMMPfam: PF07714
IPR001245
114-220 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

SGYGAPEVAMSGLCTIKSDVYSFGVVMLELLTGRKPFDSARTRSEQSLVRWATPQLHDIDALAKMVDPALEGLYPVKSLSRFADVIALCVQPEPEFRPPMSEVVEAL

Gene3D: G3DSA:1.10.510.10
114-220 no description

SGYGAPEVAMSGLCTIKSDVYSFGVVMLELLTGRKPFDSARTRSEQSLVRWATPQLHDIDALAKMVDPALEGLYPVKSLSRFADVIALCVQPEPEFRPPMSEVVEAL

superfamily: SSF56112
IPR011009
115-218 Protein kinase-like (PK-like)
Protein kinase-like domain

GYGAPEVAMSGLCTIKSDVYSFGVVMLELLTGRKPFDSARTRSEQSLVRWATPQLHDIDALAKMVDPALEGLYPVKSLSRFADVIALCVQPEPEFRPPMSEVVE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox