PRGDB00077181 (Stu.4576)

From PRG Wiki
Jump to: navigation, search
Stu.4576
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 62909430 (DN923097)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Solanum tuberosum

Comment?

45024.3 Common Scab-Challenged Tubers Solanum tuberosum cDNA clone 45024 3', mRNA sequence

DNA Sequence

TACAATCATGTCCTTTCACTGGNTAAATATAACAGTTATGTTCAAAGCAAACCTGAAGGCAATTACATACACTAATAACAAGGGCTATGCTACAAAACCTATCAAGACTGCTGAATTAACTGAAAATACAGAAGTTAAGTGAATGATATTTACATGTGCTAGCTCCAAATGAATGACAGACGAAACAACGGGGTTGGAATTGACCTTGTTGTTGGTGCTGCTAATGCTCATCATCGGTTTCTTGTTTCTTGACCAAAGACCAGTTGGTTTGCACACTACTTTCATATCCACTGCTATCACCTGATTCAATTACACGCTTGTCCATTACCCTCTCTTTAGCACCATCACGATATAAACGACCACCATGCTCCCTTGAAGCCCGTCGCTCATCACGAAAGGGAAAGTCATCAGCTTCAAGCATGTGTATTACTTGTCCCATTTTTGGCCTCTTCTGAGCATTGGGATCAACACAGCGTAATGCTACCAAAAGAACACGTTTCAGGGCTCTTGACGAAGGCTTCTCAGGTATCTTGGGATCCACAACGCCCTCGGCATTCCGGTTTGAAACCATTATTTTAAGCCAATCAACCAGAGTTACCTCTCCAGGAGGACGGCTGTAATCCACCGGATTCCTTCCAGAAATGATTTCCATAATAAGAATTCCAAAACTATACACATCACTTCTCTCATTCAACATGCCAGTGCTAGCATATTCCGGAGCAACGTAACCGAATGTTCCCATAACCCCGAGTAGTAACGTAGCTCTTCTCAGCACCCAAAAGCTTTGCCAAGCCAAAGTCTGATAACTTTTGGACTCCACTGTTTATCAAGCAAAATATTGCTTGATTTGATGTCACGGTGAACCAACTTGGGGTTCAAAGCGCTCATGAAGATAGGTTTAACCCTTTTACCTGTTTCCAGAAATGATATCCCTTCTTAATTTCCCCCGTTAGAAGAACGCAGGGACTAATTTCCTGGGGCCCCGGTTCCAAGTTCCCTGT


Protein sequences

Name Description Sequence
Stu.4576 translated coding region predicted by ESTScan from UniGene Stu.4576

XRELGTGAPGNXSLRSSNGGNXEGISFLETGKRVKPIFMSALNPKLVHRDIKSSNILLDKXVESKSYQTLAWQSFWVLRRATLLLGVMGTFGYVAPEYASTGMLNERSDVYSFGILIMEIISGRNPVDYSRPPGEVTLVDWLKIMVSNRNAEGVVDPKIPEKPSSRALKRVLLVALRCVDPNAQKRPKMGQVIHMLEADDFPFRDERRASREHGGRLYRDGAKERVMDKRVIESGDSSGYESSVQTNWSLVKKQETDDEH

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-204 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XRELGTGAPGNXSLRSSNGGNXEGISFLETGKRVKPIFMSALNPKLVHRDIKSSNILLDKXVESKSYQTLAWQSFWVLRRATLLLGVMGTFGYVAPEYASTGMLNERSDVYSFGILIMEIISGRNPVDYSRPPGEVTLVDWLKIMVSNRNAEGVVDPKIPEKPSSRALKRVLLVALRCVDPNAQKRPKMGQVIHMLEADDFPFR

HMMSmart: SM00220
IPR002290
1-203 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

XRELGTGAPGNXSLRSSNGGNXEGISFLETGKRVKPIFMSALNPKLVHRDIKSSNILLDKXVESKSYQTLAWQSFWVLRRATLLLGVMGTFGYVAPEYASTGMLNERSDVYSFGILIMEIISGRNPVDYSRPPGEVTLVDWLKIMVSNRNAEGVVDPKIPEKPSSRALKRVLLVALRCVDPNAQKRPKMGQVIHMLEADDFPF

Seg: seg
10-22 seg

GNXSLRSSNGGNX

HMMPanther: PTHR24420:SF827
42-211 SUBFAMILY NOT NAMED

LNPKLVHRDIKSSNILLDKXVESKSYQTLAWQSFWVLRRATLLLGVMGTFGYVAPEYASTGMLNERSDVYSFGILIMEIISGRNPVDYSRPPGEVTLVDWLKIMVSNRNAEGVVDPKIPEKPSSRALKRVLLVALRCVDPNAQKRPKMGQVIHMLEADDFPFRDERRASR

HMMPanther: PTHR24420
42-211 FAMILY NOT NAMED,FAMILY NOT NAMED

LNPKLVHRDIKSSNILLDKXVESKSYQTLAWQSFWVLRRATLLLGVMGTFGYVAPEYASTGMLNERSDVYSFGILIMEIISGRNPVDYSRPPGEVTLVDWLKIMVSNRNAEGVVDPKIPEKPSSRALKRVLLVALRCVDPNAQKRPKMGQVIHMLEADDFPFRDERRASR

superfamily: SSF56112
IPR011009
43-204 Protein kinase-like (PK-like)
Protein kinase-like domain

NPKLVHRDIKSSNILLDKXVESKSYQTLAWQSFWVLRRATLLLGVMGTFGYVAPEYASTGMLNERSDVYSFGILIMEIISGRNPVDYSRPPGEVTLVDWLKIMVSNRNAEGVVDPKIPEKPSSRALKRVLLVALRCVDPNAQKRPKMGQVIHMLEADDFPFR

Gene3D: G3DSA:1.10.510.10
44-196 no description

PKLVHRDIKSSNILLDKXVESKSYQTLAWQSFWVLRRATLLLGVMGTFGYVAPEYASTGMLNERSDVYSFGILIMEIISGRNPVDYSRPPGEVTLVDWLKIMVSNRNAEGVVDPKIPEKPSSRALKRVLLVALRCVDPNAQKRPKMGQVIHML

HMMPfam: PF00069
IPR017442
45-194 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

KLVHRDIKSSNILLDKXVESKSYQTLAWQSFWVLRRATLLLGVMGTFGYVAPEYASTGMLNERSDVYSFGILIMEIISGRNPVDYSRPPGEVTLVDWLKIMVSNRNAEGVVDPKIPEKPSSRALKRVLLVALRCVDPNAQKRPKMGQVIH

PatternScan: PS00108
IPR008271
46-58 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

LVHRDIKSSNILL

Seg: seg
166-177 seg

RALKRVLLVALR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox