PRGDB00077188 (Stu.5299)

From PRG Wiki
Jump to: navigation, search
Stu.5299
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 39833042 (CK276064)
Gene Class Mlo-like
Domain Type MLO
Gene Species Solanum tuberosum

Comment?

EST722142 potato abiotic stress cDNA library Solanum tuberosum cDNA clone POADR21 5' end, mRNA sequence

DNA Sequence

GTGGAGGCGGAGAAGGAGACACATTTGGAATTTACCCCTACTTGGGTGGTCGCCGCCGTCTGCACCGTCATCGTTGCCATTTCTCTAGCCGCTGAGCGACTCATCCATTATACTGGAAAGTATCTGAAGAAGAAGAATCAGAAGCCTTTATATGAAGCGCTACAGAAAGTTAAAGAAGAGTTGATGCTTTTGGGGTTTATATCCCTTTTACTGACGGTGCTTCAAAGTAGCATAGTCAAGATTTGTGTGCCTAAAGATGTGGTCATGCACTTACTACCATGTTCATTATCGGATGCCCCTTCTCATGAATCACAACATCATCGGCGGCTGTTAGTTGAAGAAGAAGAAGCTGCTGCTGCTGGCTATTGCACTGCAAAACATAAGGTCCCATTACTCTCTCTTGAAGCGTTGCATCACCTTCACATTTTCATCTTTGTCCTTGCAATTGTTCACGTGACTTTCTCTCTTCTGACAGTTGTATTTGGAGGAGCCAAGATACGTCAATGGAAGCACTGGGAGGACAGTATTGCAAAAGCTAATTATGAGACTGCACATGTTTTAAAACCACGGGTTACACATGTCCAGCAACACGATTTCATCAGGGACCGATTTGTGGGTATGGGCAAACGCTCAGCCATTTTTGGTTGGATGCACTCTTTCTTTAAGCAGTTTTATGGTTCTGTCAGCAAGTCAGATTATGCTGCTCTGCGTTTGGGGTTCATTATGACACATTGCAAGCAAAACCCAAAATTTAATTTTCACAAGTACATGATTCGTGCTCTGGAAGATGATTTTAAGACTGTCGTCGGTATCAGTTGGTATCTCTGGGTATTTGTTGTCATCTTCTTGTTTCTGAATGGTTATGGGGTGGCATACATACTTCTGGATTGCATTCATTCCTTTTGTTCTTCTGATTTGCGGTGGCACAAAGTTGGAGCATGTAATTATTCAGTTAGCTCATGAGG


Protein sequences

Name Description Sequence
Stu.5299 translated coding region predicted by ESTScan from UniGene Stu.5299

VEAEKETHLEFTPTWVVAAVCTVIVAISLAAERLIHYTGKYLKKKNQKPLYEALQKVKEELMLLGFISLLLTVLQSSIVKICVPKDVVMHLLPCSLSDAPSHESQHHRRLLVEEEEAAAAGYCTAKHKVPLLSLEALHHLHIFIFVLAIVHVTFSLLTVVFGGAKIRQWKHWEDSIAKANYETAHVLKPRVTHVQQHDFIRDRFVGMGKRSAIFGWMHSFFKQFYGSVSKSDYAALRLGFIMTHCKQNPKFNFHKYMIRALEDDFKTVVGISWYLW

Domains

Domain Start-End Description Sequence

HMMPfam: PF03094
IPR004326
5-276 Mlo
Mlo-related protein

KETHLEFTPTWVVAAVCTVIVAISLAAERLIHYTGKYLKKKNQKPLYEALQKVKEELMLLGFISLLLTVLQSSIVKICVPKDVVMHLLPCSLSDAPSHESQHHRRLLVEEEEAAAAGYCTAKHKVPLLSLEALHHLHIFIFVLAIVHVTFSLLTVVFGGAKIRQWKHWEDSIAKANYETAHVLKPRVTHVQQHDFIRDRFVGMGKRSAIFGWMHSFFKQFYGSVSKSDYAALRLGFIMTHCKQNPKFNFHKYMIRALEDDFKTVVGISWYLW

Seg: seg
16-27 seg

VVAAVCTVIVAI

Seg: seg
113-120 seg

EEEEAAAA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox