PRGDB00077220 (Stu.9745)

From PRG Wiki
Jump to: navigation, search
Stu.9745
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 53774315 (CV491967)
Gene Class T
Domain Type TIR, LRR
Gene Species Solanum tuberosum

Comment?

35893.1 Cold Sweetening B Solanum tuberosum cDNA clone 35893 5', mRNA sequence

DNA Sequence

AACATAAGTGAACTTTGTTCAATGGCCACCAGACAAATAGCGTATGATCAATCATCCAACACTTATGGAAAGTCATATGATGTGTTTTTGAGTTTCAAAAGTGAAGACAGTGGTAAAAATTTCACAAATCACCTCTCTACAGCTTTAAATCAAGCCGGATTTTGCACGTTCGAAGGTGGTGATGATAATGAATCAAGAAGAGAAGAAGACATTAATTCAAAGTTGTCTAAAGCAATACAAGAATCAAAGATGTGTATAATTGTATTCTCACAAAATTATGCATCTTCTAGTTGGTGCTTGGATCAACTTGTTTCCATTCTTGAAAACAAAATGAAGTTTGCATGTATGATATTGCCTATTTTCTACCATGTTGATCCTTCCAATCTAAGGAAGCACAAGGGAAGTTTTGGAGAAGCATTAAATAAGATTATTTAAATACTTTTATCACTCTATAACTGCTTTTTATCCGCAACAAACATCCACCAATATAATAGTACTCTTTTTATAAACTCaaaaaaaaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Stu.9745 translated coding region predicted by ESTScan from UniGene Stu.9745

NISELCSMATRQIAYDQSSNTYGKSYDVFLSFKSEDSGKNFTNHLSTALNQAGFCTFEGGDDNESRREEDINSKLSKAIQESKMCIIVFSQNYASSSWCLDQLVSILENKMKFACMILPIFYHVDPSNLRKHKGSFGEALNKII

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
14-143 Toll/Interleukin receptor TIR domain
Toll-Interleukin receptor

AYDQSSNTYGKSYDVFLSFKSEDSGKNFTNHLSTALNQAGFCTFEGGDDNESRREEDINSKLSKAIQESKMCIIVFSQNYASSSWCLDQLVSILENKMKFACMILPIFYHVDPSNLRKHKGSFGEALNKI

Gene3D: G3DSA:3.40.50.10140
23-142 no description

GKSYDVFLSFKSEDSGKNFTNHLSTALNQAGFCTFEGGDDNESRREEDINSKLSKAIQESKMCIIVFSQNYASSSWCLDQLVSILENKMKFACMILPIFYHVDPSNLRKHKGSFGEALNK

ProfileScan: PS50104
IPR000157
24-144 TIR
Toll-Interleukin receptor

KSYDVFLSFKSEDSGKNFTNHLSTALNQAGFCTFEGGDDNESRREEDINSKLSKAIQESKMCIIVFSQNYASSSWCLDQLVSILENKMKFACMILPIFYHVDPSNLRKHKGSFGEALNKII

HMMSmart: SM00255
IPR000157
25-144 Toll
Toll/interleukin-1 receptor homology (TIR) domain

SYDVFLSFKSEDSGKNFTNHLSTALNQAGFCTFEGGDDNESRREEDINSKLSKAIQESKMCIIVFSQNYASSSWCLDQLVSILENKMKFACMILPIFYHVDPSNLRKHKGSFGEALNKII

HMMPfam: PF01582
IPR000157
28-143 TIR
Toll-Interleukin receptor

VFLSFKSEDSGKNFTNHLSTALNQAGFCTFEGGDDNESRREEDINSKLSKAIQESKMCIIVFSQNYASSSWCLDQLVSILENKMKFACMILPIFYHVDPSNLRKHKGSFGEALNKI

HMMPanther: PTHR23155:SF252
42-138 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

TNHLSTALNQAGFCTFEGGDDNESRREEDINSKLSKAIQESKMCIIVFSQNYASSSWCLDQLVSILENKMKFACMILPIFYHVDPSNLRKHKGSFGE

HMMPanther: PTHR23155
42-138 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

TNHLSTALNQAGFCTFEGGDDNESRREEDINSKLSKAIQESKMCIIVFSQNYASSSWCLDQLVSILENKMKFACMILPIFYHVDPSNLRKHKGSFGE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox